Sequence Report: ERK1ps6

General information about the entry
Gene nameERK1ps6
Primary accession numberErk1ps6.AA
Secondary accession number(s).
Sequence typeProtein
Sequence originSugen
Sequence length179
Sequence description.
>ERK1ps6_Mm
FLTEYVATRWY*APEIMLISKGYTKSIDIWSVGFILAEMLSXKRPIFPGKHYLEQLNHILCILCSPSQQDLNCIINMKAR
NYLQSLPSKTKVAWAKLFHTSDSKALDLMDWMLTFNRNKCITVQEALAHPYXYYDPTDEPVAEELFTFHMALGNLPKERL
KELIFQDMDHFQPEAAEGP