Sequence Report: SRPK1ps

General information about the entry
Gene nameSRPK1ps
Primary accession numberSRPK1ps.AA
Secondary accession number(s).
Sequence typeProtein
Sequence originSugen
Sequence length376
Sequence description.
>SRPK1ps_Mm
RQAELLEK*MQEIEDRKKESGPGQKKT*QARRXSEXPVERPLTENPPNKMTQEKLEEANSIGQDQTLTEHVGEGGAPEIN
CNGVIGIINYPENTNNETLSLKEDLHNANDCDVHTLKQETSFLNSSNGDSSPSQDPDXCTPTASEVSETMVCQSSVEQSL
TEQDITHLQESIQGDTPSGDEQEHNGALESKGKFSAGNFLINPLEPKNTEKLKVKIADLGSAC*VHKYFTEDFQTRQFWS
LKVLIGSGYNTPADIWSTACMAFELGTGDYLFEPHSGEDXYT*DEDHIAWIIELLGKVPPKLIVAGKYSKEFFTKKGDLK
HITKLKPWGLLEVLVEKYEWPQEAAGFTDFLLPMLQLMSEKRATDAECXRHPWLNS