Sequence Report: MARKps21

General information about the entry
Gene nameMARKps21
Primary accession numberMARKps21.kin_dom
Secondary accession number(s).
Sequence typeProtein Kinase Domain
Sequence originSugen Kinome
Sequence length147
Sequence description.
>MARKps21_Hs
KILHHPNIIQLYQVIDKAETI*VVMEYARGGELHHLIHHHHDIKDGEEAWIMLRQILSALQYCHLKNITHPDLKLQNILL
NEEGKIKIIDFGFSTIFR.SGLLKTFCGVYPYMVTEIFLGLGYR*LAIDIYCLSSILYSTMSGSLPF