Protein (view, download) , Domain (view, download)

TRRAP_Hsap_PIKK_TRRAP               --------------------------------------------------
TRRAP_Mmus_PIKK_TRRAP               --------------------------------------------------
TRRAP_Spur_PIKK_TRRAP               --------------------------------------------------
CG2905_Dmel_PIKK_TRRAP              --------------------------------------------------
AqueK048_Aque_PIKK_TRRAP            --------------------------------------------------
PDHK4_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK4_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK3_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK3_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK2_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK2_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK1_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK1_Mmus_PDHK_PDHK                --------------------------------------------------
PDK_Dmel_PDHK_PDHK                  --------------------------------------------------
PDHK_Spur_PDHK_PDHK                 --------------------------------------------------
aSWK467_Cele_PDHK_PDHK              --------------------------------------------------
pdhk-2_Cele_PDHK_PDHK               --------------------------------------------------
CC1G_15212_Ccin_PDHK_PDHK           --------------------------------------------------
BCKDK_Mmus_PDHK_BCKDK               --------------------------------------------------
BCKDK_Hsap_PDHK_BCKDK               --------------------------------------------------
BCKDK_Spur_PDHK_BCKDK               --------------------------------------------------
CC1G_13956_Ccin_PDHK_BCKDK          --------------------------------------------------
CC1G_00337_Ccin_PDHK_BCKDK          --------------------------------------------------
13282_Tthe_HisK                     --------------------------------------------------
13760_Tthe_HisK                     --------------------------------------------------
HisK_l-1_Smoe_HisK                  --------------------------------------------------
HisK_l-2_Smoe_HisK                  --------------------------------------------------
HisK_p_Smoe_HisK                    --------------------------------------------------
HisK_d_Smoe_HisK                    --------------------------------------------------
DhkI_Ddis_HisK                      --------------------------------------------------
DhkI_C2d_Ddis_HisK                  --------------------------------------------------
DDB0190004_Ddis_AFK                 --------------------------------------------------
DDB0190056_Ddis_AFK                 --------------------------------------------------
DDB0187708_Ddis_AFK                 --------------------------------------------------
DDB0231760_Ddis_AFK                 --------------------------------------------------
DhkJ_Ddis_HisK                      --------------------------------------------------
CC1G_13258_Ccin_HisK                --------------------------------------------------
HisK_m_Smoe_HisK                    --------------------------------------------------
HisK_g_Smoe_HisK                    --------------------------------------------------
HisK_c_Smoe_HisK                    --------------------------------------------------
HisK_h_Smoe_HisK                    --------------------------------------------------
HisK_i_Smoe_HisK                    --------------------------------------------------
HisK_b_Smoe_HisK                    --------------------------------------------------
HisK_e_Smoe_HisK                    --------------------------------------------------
HisK_f_Smoe_HisK                    --------------------------------------------------
10844_Tthe_HisK                     --------------------------------------------------
10868_Tthe_HisK                     --------------------------------------------------
25684_Tthe_HisK                     --------------------------------------------------
7983_Tthe_HisK                      --------------------------------------------------
6570_Tthe_HisK                      --------------------------------------------------
6574_Tthe_HisK                      --------------------------------------------------
10845_Tthe_HisK                     --------------------------------------------------
14557_Tthe_HisK                     --------------------------------------------------
17200_Tthe_HisK                     --------------------------------------------------
4112_Tthe_HisK                      --------------------------------------------------
4145_Tthe_HisK                      --------------------------------------------------
Col4A3BP_Mmus_Col4A3BP              --------------------------------------------------
Col4A3BP_Hsap_Col4A3BP              --------------------------------------------------
SMG1_Hsap_PIKK_SMG1                 --------------------------------------------------
SMG1_Mmus_PIKK_SMG1                 --------------------------------------------------
SMG1_Spur_PIKK_SMG1                 --------------------------------------------------
AqueK047_Aque_PIKK_SMG1             --------------------------------------------------
CG4549_Dmel_PIKK_SMG1               --------------------------------------------------
RIOK2_Hsap_RIO_RIO2                 --------------------------------------------------
RIOK2_Mmus_RIO_RIO2                 --------------------------------------------------
RIO2-2_Smoe_RIO_RIO2                --------------------------------------------------
RIO2-1_Smoe_RIO_RIO2                --------------------------------------------------
RIO2_Spur_RIO_RIO2                  --------------------------------------------------
CG11859_Dmel_RIO_RIO2               --------------------------------------------------
aSWK440_Cele_RIO_RIO2               --------------------------------------------------
RIO2_Scer_RIO_RIO2                  --------------------------------------------------
CC1G_13652_Ccin_RIO_RIO2            --------------------------------------------------
Rio2_Ddis_RIO_RIO2                  --------------------------------------------------
AqueK050_Aque_RIO_RIO2              --------------------------------------------------
GK011_Glam_RIO_RIO2                 --------------------------------------------------
27105_Tthe_RIO_RIO2                 --------------------------------------------------
RIOK3_Hsap_RIO_RIO3                 --------------------------------------------------
RIOK3_Mmus_RIO_RIO3                 --------------------------------------------------
RIO3_Spur_RIO_RIO3                  --------------------------------------------------
AqueK051_Aque_RIO_RIO3              --------------------------------------------------
CG3008_Dmel_RIO_RIO3                --------------------------------------------------
ZK632.3_Cele_RIO_RIO3               --------------------------------------------------
RIOK1_Hsap_RIO_RIO1                 --------------------------------------------------
RIOK1_Mmus_RIO_RIO1                 --------------------------------------------------
RIO1_Spur_RIO_RIO1                  --------------------------------------------------
RIO1-2_Smoe_RIO_RIO1                --------------------------------------------------
RIO1-1_Smoe_RIO_RIO1                --------------------------------------------------
AqueK049_Aque_RIO_RIO1              --------------------------------------------------
CG11660_Dmel_RIO_RIO1               --------------------------------------------------
Rio1_Ddis_RIO_RIO1                  --------------------------------------------------
M01B12.5_Cele_RIO_RIO1              --------------------------------------------------
CC1G_04984_Ccin_RIO_RIO1            --------------------------------------------------
RIO1_Scer_RIO_RIO1                  --------------------------------------------------
11147_Tthe_RIO_RIO1                 --------------------------------------------------
FRAP_Hsap_PIKK_FRAP                 --------------------------------------------------
FRAP_Mmus_PIKK_FRAP                 --------------------------------------------------
AqueK046_Aque_PIKK_FRAP             --------------------------------------------------
TOR_Dmel_PIKK_FRAP                  --------------------------------------------------
Tor_Ddis_PIKK_FRAP                  --------------------------------------------------
CC1G_00894_Ccin_PIKK_FRAP           --------------------------------------------------
TOR1_Scer_PIKK_FRAP                 --------------------------------------------------
TOR2_Scer_PIKK_FRAP                 --------------------------------------------------
FRAP_Smoe_PIKK_FRAP                 --------------------------------------------------
B0261.2_Cele_PIKK_FRAP              --------------------------------------------------
20618_Tthe_PI3K_PI4K                --------------------------------------------------
20619_Tthe_PI3K_PI4K                --------------------------------------------------
ATR_Mmus_PIKK_ATR                   --------------------------------------------------
ATR_Hsap_PIKK_ATR                   --------------------------------------------------
ATR_Spur_PIKK_ATR                   --------------------------------------------------
AqueK044_Aque_PIKK_ATR              --------------------------------------------------
ATR_Smoe_PIKK_ATR                   --------------------------------------------------
CC1G_08126_Ccin_PIKK_ATR            --------------------------------------------------
ATM_Mmus_PIKK_ATM                   --------------------------------------------------
ATM_Hsap_PIKK_ATM                   --------------------------------------------------
ATM_Smoe_PIKK_ATM                   --------------------------------------------------
AqueK043_Aque_PIKK_ATM              --------------------------------------------------
ATMa_Spur_PIKK_ATM                  --------------------------------------------------
n737_Tthe_PI3K_PI4K                 --------------------------------------------------
n858_Tthe_PI3K_PI4K                 --------------------------------------------------
n8_Tthe_PI3K_PI4K                   --------------------------------------------------
n73_Tthe_PI3K_PI4K                  --------------------------------------------------
n545_Tthe_PI3K_PI4K                 --------------------------------------------------
n502_Tthe_PI3K_PI4K                 --------------------------------------------------
n508_Tthe_PI3K_PI4K                 --------------------------------------------------
n131_Tthe_PI3K_PI4K                 --------------------------------------------------
DNAPK_Mmus_PIKK_DNAPK               MAEEGTGVRCWLLQLQEFLSAADRCSAAGASYQLIRSLGQECVLSTSSAV
DNAPK_Hsap_PIKK_DNAPK               MAGSGAGVRCSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAV
DNAPK_Spur_PIKK_DNAPK               --------------------------------------------------
AqueK045_Aque_PIKK_DNAPK            --------------------------------------------------
DNAPK_Smoe_PIKK_DNAPK               --------------------------------------------------
DNAPK_Ddis_PIKK_DNAPK               MDNIYQRIENYLIKLFQTISETNNNNNNNNTNNNVGIKFENDLLLVNELG
ADCK1_Mmus_ABC1_ABC1-B              --------------------------------------------------
ADCK1_Hsap_ABC1_ABC1-B              --------------------------------------------------
ADCK1_Spur_ABC1_ABC1-B              --------------------------------------------------
CG3608_Dmel_ABC1_ABC1-B             --------------------------------------------------
D2023.6_Cele_ABC1_ABC1-B            --------------------------------------------------
AqueK029_Aque_ABC1_ABC1-B           --------------------------------------------------
ABC1-B_b_Smoe_ABC1_ABC1-B           --------------------------------------------------
YLR253W_Scer_ABC1_ABC1-B            --------------------------------------------------
CC1G_14173_Ccin_ABC1_ABC1-B         --------------------------------------------------
ADCK5_Mmus_ABC1_ABC1-D              --------------------------------------------------
ADCK5_Hsap_ABC1_ABC1-D              --------------------------------------------------
AqueK031_Aque_ABC1_ABC1-D           --------------------------------------------------
ADCK5_Spur_ABC1_ABC1-D              --------------------------------------------------
CG7616_Dmel_ABC1_ABC1-D             --------------------------------------------------
AdckB2_Ddis_ABC1_ABC1-D             --------------------------------------------------
ABC1-B_a_Smoe_ABC1_ABC1-B           --------------------------------------------------
14263_Tthe_ABC1_ABC1-B              --------------------------------------------------
CC1G_15805_Ccin_ABC1_ABC1-B         --------------------------------------------------
ABC1-B-p1_b-1_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_b-2_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_a-2_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_a-1_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-D_b_Smoe_ABC1_ABC1-D           --------------------------------------------------
ABC1-D_a_Smoe_ABC1_ABC1-D           --------------------------------------------------
ABC1-E_b_Smoe_ABC1_ABC1-E           --------------------------------------------------
ABC1-E_a_Smoe_ABC1_ABC1-E           --------------------------------------------------
ABC1-F_d_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_e_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_a_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_b_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_c_Smoe_ABC1_ABC1-F           --------------------------------------------------
ADCK2_Mmus_ABC1_ABC1-C              --------------------------------------------------
ADCK2_Hsap_ABC1_ABC1-C              --------------------------------------------------
ADCK2_Spur_ABC1_ABC1-C              --------------------------------------------------
AqueK030_Aque_ABC1_ABC1-C           --------------------------------------------------
YPL109C_Scer_ABC1_ABC1-C            --------------------------------------------------
CC1G_01824_Ccin_ABC1_ABC1-C         --------------------------------------------------
ABC1-C-1_Smoe_ABC1_ABC1-C           --------------------------------------------------
ABC1-C-2_Smoe_ABC1_ABC1-C           --------------------------------------------------
AdckC_Ddis_ABC1_ABC1-C              --------------------------------------------------
ADCK4_Mmus_ABC1_ABC1-A              --------------------------------------------------
ADCK4_Hsap_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Mmus_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Hsap_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Spur_ABC1_ABC1-A              --------------------------------------------------
AqueK028_Aque_ABC1_ABC1-A           --------------------------------------------------
CG4410_Dmel_ABC1_ABC1-A             --------------------------------------------------
ABC1-A_Smoe_ABC1_ABC1-A             --------------------------------------------------
C35D10.4_Cele_ABC1_ABC1-A           --------------------------------------------------
AdckA_Ddis_ABC1_ABC1-A              --------------------------------------------------
ABC1_Scer_ABC1_ABC1-A               --------------------------------------------------
CC1G_11046_Ccin_ABC1_ABC1-A         --------------------------------------------------
30099_Tthe_ABC1_ABC1-A              --------------------------------------------------
BCR_Mmus_BCR                        --------------------------------------------------
BCR_Hsap_BCR                        --------------------------------------------------
ABR_Hsap_BCR                        --------------------------------------------------
ABR_Mmus_BCR                        --------------------------------------------------
BCR_Spur_BCR                        --------------------------------------------------
BLVRA_Hsap_BLVRA                    --------------------------------------------------
BLVRA_Mmus_BLVRA                    --------------------------------------------------
TAF1_Hsap_TAF1                      --------------------------------------------------
TAF1_Mmus_TAF1                      --------------------------------------------------
TAF1L_Hsap_TAF1                     --------------------------------------------------
TAF1_Spur_TAF1                      --------------------------------------------------
Taf250_Dmel_TAF1                    --------------------------------------------------
AqueK052_Aque_TAF1                  --------------------------------------------------
taf-1_Cele_TAF1                     --------------------------------------------------
TAF1-1_Smoe_TAF1                    --------------------------------------------------
TAF1-2_Smoe_TAF1                    --------------------------------------------------
G11_Hsap_G11                        --------------------------------------------------
G11_Mmus_G11                        --------------------------------------------------
G11_Spur_G11                        --------------------------------------------------
TIF1g_Hsap_TIF1                     --------------------------------------------------
TIF1g_Mmus_TIF1                     --------------------------------------------------
TIF1a_Hsap_TIF1                     --------------------------------------------------
TIF1a_Mmus_TIF1                     --------------------------------------------------
TIF1b_Hsap_TIF1                     --------------------------------------------------
TIF1b_Mmus_TIF1                     --------------------------------------------------
TIF1D_Hsap_TIF1                     --------------------------------------------------
TIF1D_Mmus_TIF1                     --------------------------------------------------
GTF2F1_Hsap_GTF2F1                  --------------------------------------------------
GTF2F1_Mmus_GTF2F1                  --------------------------------------------------
BAZ1A_Hsap_BAZ                      --------------------------------------------------
BAZ1A_Mmus_BAZ                      --------------------------------------------------
BAZ1B_Hsap_BAZ                      --------------------------------------------------
BAZ1B_Mmus_BAZ                      --------------------------------------------------
FASTK_Hsap_FAST                     --------------------------------------------------
FASTK_Mmus_FAST                     --------------------------------------------------
AlphaK3_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK3_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK2_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK2_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
CC1G_14582_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_06337_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_07428_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_08873_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_12594_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_02529_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_10953_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_00657_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_11146_Ccin_Alpha_Alpha-Un      --------------------------------------------------
eEF2K_Mmus_Alpha_eEF2K              --------------------------------------------------
eEF2K_Hsap_Alpha_eEF2K              --------------------------------------------------
eEF2K_Spur_Alpha_eEF2K              --------------------------------------------------
AqueK040_Aque_Alpha_eEF2K           --------------------------------------------------
efk-1_Cele_Alpha_eEF2K              --------------------------------------------------
MHCK-A_Ddis_Alpha_MHCK              --------------------------------------------------
MHCK-B_Ddis_Alpha_MHCK              --------------------------------------------------
ChaK2_Mmus_Alpha_ChaK               --------------------------------------------------
ChaK2_Hsap_Alpha_ChaK               --------------------------------------------------
ChaK1_Mmus_Alpha_ChaK               --------------------------------------------------
ChaK1_Hsap_Alpha_ChaK               --------------------------------------------------
AqueK032_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK036_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK039_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK033_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK037_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK034_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK035_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK038_Aque_Alpha_Alpha-spon      --------------------------------------------------
15769_Tthe_Alpha_VWL                --------------------------------------------------
15771_Tthe_Alpha_VWL                --------------------------------------------------
25428_Tthe_Alpha_VWL                --------------------------------------------------
6257_Tthe_Alpha_VWL                 --------------------------------------------------
6258_Tthe_Alpha_VWL                 --------------------------------------------------
24053_Tthe_Alpha_VWL                --------------------------------------------------
29299_Tthe_Alpha_VWL                --------------------------------------------------
7218_Tthe_Alpha_VWL                 --------------------------------------------------
AlphaK1_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK1_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
BRDT_Mmus_BRD                       --------------------------------------------------
BRDT_Hsap_BRD                       --------------------------------------------------
BRD4_Mmus_BRD                       --------------------------------------------------
BRD4_Hsap_BRD                       --------------------------------------------------
BRD3_Mmus_BRD                       --------------------------------------------------
BRD3_Hsap_BRD                       --------------------------------------------------
BRD2_Mmus_BRD                       --------------------------------------------------
BRD2_Hsap_BRD                       --------------------------------------------------
BRD_Spur_BRD                        --------------------------------------------------
AqueK041_Aque_BRD                   --------------------------------------------------
Y32H12A.7_Cele_ABC1_ABC1-C          --------------------------------------------------
17202_Tthe_HisK                     --------------------------------------------------
4146_Tthe_HisK                      --------------------------------------------------
7982_Tthe_HisK                      --------------------------------------------------
GK010_Glam_RIO_RIO1                 --------------------------------------------------
14574_Tthe_HisK                     --------------------------------------------------
smg-1_Cele_PIKK_SMG1                --------------------------------------------------
AdckB1_Ddis_ABC1_ABC1-B             --------------------------------------------------
MHCK-C_Ddis_Alpha_MHCK              --------------------------------------------------
26487_Tthe_HisK                     --------------------------------------------------
13283_Tthe_HisK                     --------------------------------------------------
16249_Tthe_HisK                     --------------------------------------------------
28479_Tthe_HisK                     --------------------------------------------------
RhoGAP1A_Dmel_BCR                   --------------------------------------------------
ABC1-G_Smoe_ABC1_ABC1-G             --------------------------------------------------
DhkA_Ddis_HisK                      --------------------------------------------------
DhkK_Ddis_HisK                      --------------------------------------------------
23657_Tthe_ABC1_ABC1-B              --------------------------------------------------
17204_Tthe_HisK                     --------------------------------------------------
17203_Tthe_HisK                     --------------------------------------------------
HisK_a_Smoe_HisK                    --------------------------------------------------
atm-1_Cele_PIKK_ATM                 --------------------------------------------------
Y119C1B.8_Cele_BRD                  --------------------------------------------------
DhkL_Ddis_HisK                      --------------------------------------------------
DokA_Ddis_HisK                      --------------------------------------------------
MHCK-D_Ddis_Alpha_MHCK              --------------------------------------------------
21169_Tthe_HisK                     --------------------------------------------------
22236_Tthe_HisK                     --------------------------------------------------
FRAP_Spur_PIKK_FRAP                 --------------------------------------------------
SMG1_Smoe_PIKK_SMG1                 --------------------------------------------------
mei-41_Dmel_PIKK_ATR                --------------------------------------------------
5266_Tthe_HisK                      --------------------------------------------------
CC1G_00331_Ccin_PIKK_TRRAP          --------------------------------------------------
TRA1_Scer_PIKK_TRRAP                --------------------------------------------------
CG6535_Dmel_PIKK_ATM                --------------------------------------------------
DhkB_Ddis_HisK                      --------------------------------------------------
DhkC_Ddis_HisK                      --------------------------------------------------
DhkE_Ddis_HisK                      --------------------------------------------------
DhkH_Ddis_HisK                      --------------------------------------------------
TAF1_Ddis_TAF1                      --------------------------------------------------
12346_Tthe_HisK                     --------------------------------------------------
16839_Tthe_HisK                     --------------------------------------------------
15614_Tthe_HisK                     --------------------------------------------------
5265_Tthe_HisK                      --------------------------------------------------
7183_Tthe_HisK                      --------------------------------------------------
13773_Tthe_PI3K_PI4K                --------------------------------------------------
AqueK042_Aque_HisK                  --------------------------------------------------
ABC1-B-p1_d_Smoe_ABC1_ABC1-B-p      --------------------------------------------------
ABC1-B-p1_c_Smoe_ABC1_ABC1-B-p      --------------------------------------------------
ATR_Ddis_PIKK_ATR                   --------------------------------------------------
DhkD_Ddis_HisK                      --------------------------------------------------
DhkF_Ddis_HisK                      --------------------------------------------------
DhkM_Ddis_HisK                      --------------------------------------------------
SMG1_Ddis_PIKK_SMG1                 --------------------------------------------------
VwkA_Ddis_Alpha_VWL                 --------------------------------------------------
11424_Tthe_HisK                     --------------------------------------------------
6390_Tthe_HisK                      --------------------------------------------------
12733_Tthe_HisK                     --------------------------------------------------
15795_Tthe_HisK                     --------------------------------------------------
15969_Tthe_HisK                     --------------------------------------------------
16246_Tthe_HisK                     --------------------------------------------------
13303_Tthe_HisK                     --------------------------------------------------
19275_Tthe_HisK                     --------------------------------------------------
8067_Tthe_HisK                      --------------------------------------------------
8442_Tthe_HisK                      --------------------------------------------------
F13C5.2_Cele_BRD                    --------------------------------------------------
HisK_q_Smoe_HisK                    --------------------------------------------------
C47D12.1_Cele_PIKK_TRRAP            --------------------------------------------------
TAF1_Scer_TAF1                      --------------------------------------------------
CC1G_13701_Ccin_TAF1                --------------------------------------------------
YIL042C_Scer_PDHK_PDHK              --------------------------------------------------
17637_Tthe_ABC1_ABC1-B              --------------------------------------------------
15326_Tthe_HisK                     --------------------------------------------------
16029_Tthe_HisK                     --------------------------------------------------
19671_Tthe_HisK                     --------------------------------------------------
22059_Tthe_HisK                     --------------------------------------------------
22277_Tthe_HisK                     --------------------------------------------------
30008_Tthe_HisK                     --------------------------------------------------
3312_Tthe_HisK                      --------------------------------------------------
6037_Tthe_HisK                      --------------------------------------------------
7076_Tthe_HisK                      --------------------------------------------------
7838_Tthe_HisK                      --------------------------------------------------
7820_Tthe_HisK                      --------------------------------------------------
F57C7.1b_Cele_BRD                   --------------------------------------------------
bon_Dmel_TIF1                       --------------------------------------------------
SLN1_Scer_HisK                      --------------------------------------------------
MEC1_Scer_PIKK_ATR                  --------------------------------------------------
G11_Ddis_G11                        --------------------------------------------------
13539_Tthe_HisK                     --------------------------------------------------
15301_Tthe_HisK                     --------------------------------------------------
17211_Tthe_HisK                     --------------------------------------------------
17212_Tthe_HisK                     --------------------------------------------------
17177_Tthe_HisK                     --------------------------------------------------
19862_Tthe_HisK                     --------------------------------------------------
14296_Tthe_HisK                     --------------------------------------------------
23233_Tthe_HisK                     --------------------------------------------------
2892_Tthe_HisK                      --------------------------------------------------
19891_Tthe_HisK                     --------------------------------------------------
22114_Tthe_HisK                     --------------------------------------------------
25571_Tthe_HisK                     --------------------------------------------------
28692_Tthe_HisK                     --------------------------------------------------
29191_Tthe_HisK                     --------------------------------------------------
3209_Tthe_HisK                      --------------------------------------------------
4106_Tthe_HisK                      --------------------------------------------------
TIF1_Spur_TIF1                      --------------------------------------------------
n29_Tthe_PI3K_PI4K                  --------------------------------------------------
n679_Tthe_PI3K_PI4K                 --------------------------------------------------
CC1G_06302_Ccin_PIKK_PI3K           --------------------------------------------------
CC1G_00839_Ccin_PIKK_ATM            --------------------------------------------------
10338_Tthe_Alpha_Alpha-Unclass      --------------------------------------------------
ak1_Ddis_Alpha_Alpha-Unclassif      --------------------------------------------------
10472_Tthe_HisK                     --------------------------------------------------
1075_Tthe_HisK                      --------------------------------------------------
12411_Tthe_HisK                     --------------------------------------------------
18664_Tthe_HisK                     --------------------------------------------------
11754_Tthe_HisK                     --------------------------------------------------
21980_Tthe_HisK                     --------------------------------------------------
22113_Tthe_HisK                     --------------------------------------------------
22136_Tthe_HisK                     --------------------------------------------------
22512_Tthe_HisK                     --------------------------------------------------
26654_Tthe_HisK                     --------------------------------------------------
5989_Tthe_HisK                      --------------------------------------------------
ABC1-H_Smoe_ABC1_ABC1-H             --------------------------------------------------
HisK_j_Smoe_HisK                    --------------------------------------------------
HisK_n_Smoe_HisK                    --------------------------------------------------
TRRAP_Ddis_PIKK_TRRAP               --------------------------------------------------
4594_Tthe_HisK                      --------------------------------------------------
6859_Tthe_HisK                      --------------------------------------------------
6877_Tthe_HisK                      --------------------------------------------------
TEL1_Scer_PIKK_ATM                  --------------------------------------------------
CC1G_14302_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_14422_Ccin_HisK                --------------------------------------------------
DDB0220693_Ddis_BRD                 --------------------------------------------------
n566_Tthe_HisK                      --------------------------------------------------
n573_Tthe_CAK                       --------------------------------------------------
n558_Tthe_CAK                       --------------------------------------------------
n623_Tthe_CAK                       --------------------------------------------------
29569_Tthe_PI3K_PI4K                --------------------------------------------------
DDB0220694_Ddis_BRD                 --------------------------------------------------
15306_Tthe_HisK                     --------------------------------------------------
n619_Tthe_HisK                      --------------------------------------------------
CC1G_13883_Ccin_PIKK_PI4K           --------------------------------------------------
CC1G_04234_Ccin_PIKK_PI4K           --------------------------------------------------
n596_Tthe_PI3_PI4                   --------------------------------------------------
CC1G_02967_Ccin_HisK                --------------------------------------------------
atl-1_Cele_PIKK_ATR                 --------------------------------------------------
6605_Tthe_TAF1                      --------------------------------------------------
CC1G_05545_Ccin_HisK                --------------------------------------------------
HisK_o_Smoe_HisK                    --------------------------------------------------


TRRAP_Hsap_PIKK_TRRAP               --------------------------------------------------
TRRAP_Mmus_PIKK_TRRAP               --------------------------------------------------
TRRAP_Spur_PIKK_TRRAP               --------------------------------------------------
CG2905_Dmel_PIKK_TRRAP              --------------------------------------------------
AqueK048_Aque_PIKK_TRRAP            --------------------------------------------------
PDHK4_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK4_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK3_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK3_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK2_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK2_Mmus_PDHK_PDHK                --------------------------------------------------
PDHK1_Hsap_PDHK_PDHK                --------------------------------------------------
PDHK1_Mmus_PDHK_PDHK                --------------------------------------------------
PDK_Dmel_PDHK_PDHK                  --------------------------------------------------
PDHK_Spur_PDHK_PDHK                 --------------------------------------------------
aSWK467_Cele_PDHK_PDHK              --------------------------------------------------
pdhk-2_Cele_PDHK_PDHK               --------------------------------------------------
CC1G_15212_Ccin_PDHK_PDHK           --------------------------------------------------
BCKDK_Mmus_PDHK_BCKDK               --------------------------------------------------
BCKDK_Hsap_PDHK_BCKDK               --------------------------------------------------
BCKDK_Spur_PDHK_BCKDK               --------------------------------------------------
CC1G_13956_Ccin_PDHK_BCKDK          --------------------------------------------------
CC1G_00337_Ccin_PDHK_BCKDK          --------------------------------------------------
13282_Tthe_HisK                     --------------------------------------------------
13760_Tthe_HisK                     --------------------------------------------------
HisK_l-1_Smoe_HisK                  --------------------------------------------------
HisK_l-2_Smoe_HisK                  --------------------------------------------------
HisK_p_Smoe_HisK                    --------------------------------------------------
HisK_d_Smoe_HisK                    --------------------------------------------------
DhkI_Ddis_HisK                      --------------------------------------------------
DhkI_C2d_Ddis_HisK                  --------------------------------------------------
DDB0190004_Ddis_AFK                 --------------------------------------------------
DDB0190056_Ddis_AFK                 --------------------------------------------------
DDB0187708_Ddis_AFK                 --------------------------------------------------
DDB0231760_Ddis_AFK                 --------------------------------------------------
DhkJ_Ddis_HisK                      --------------------------------------------------
CC1G_13258_Ccin_HisK                --------------------------------------------------
HisK_m_Smoe_HisK                    --------------------------------------------------
HisK_g_Smoe_HisK                    --------------------------------------------------
HisK_c_Smoe_HisK                    --------------------------------------------------
HisK_h_Smoe_HisK                    --------------------------------------------------
HisK_i_Smoe_HisK                    --------------------------------------------------
HisK_b_Smoe_HisK                    --------------------------------------------------
HisK_e_Smoe_HisK                    --------------------------------------------------
HisK_f_Smoe_HisK                    --------------------------------------------------
10844_Tthe_HisK                     --------------------------------------------------
10868_Tthe_HisK                     --------------------------------------------------
25684_Tthe_HisK                     --------------------------------------------------
7983_Tthe_HisK                      --------------------------------------------------
6570_Tthe_HisK                      --------------------------------------------------
6574_Tthe_HisK                      --------------------------------------------------
10845_Tthe_HisK                     --------------------------------------------------
14557_Tthe_HisK                     --------------------------------------------------
17200_Tthe_HisK                     --------------------------------------------------
4112_Tthe_HisK                      --------------------------------------------------
4145_Tthe_HisK                      --------------------------------------------------
Col4A3BP_Mmus_Col4A3BP              --------------------------------------------------
Col4A3BP_Hsap_Col4A3BP              --------------------------------------------------
SMG1_Hsap_PIKK_SMG1                 --------------------------------------------------
SMG1_Mmus_PIKK_SMG1                 --------------------------------------------------
SMG1_Spur_PIKK_SMG1                 --------------------------------------------------
AqueK047_Aque_PIKK_SMG1             --------------------------------------------------
CG4549_Dmel_PIKK_SMG1               --------------------------------------------------
RIOK2_Hsap_RIO_RIO2                 --------------------------------------------------
RIOK2_Mmus_RIO_RIO2                 --------------------------------------------------
RIO2-2_Smoe_RIO_RIO2                --------------------------------------------------
RIO2-1_Smoe_RIO_RIO2                --------------------------------------------------
RIO2_Spur_RIO_RIO2                  --------------------------------------------------
CG11859_Dmel_RIO_RIO2               --------------------------------------------------
aSWK440_Cele_RIO_RIO2               --------------------------------------------------
RIO2_Scer_RIO_RIO2                  --------------------------------------------------
CC1G_13652_Ccin_RIO_RIO2            --------------------------------------------------
Rio2_Ddis_RIO_RIO2                  --------------------------------------------------
AqueK050_Aque_RIO_RIO2              --------------------------------------------------
GK011_Glam_RIO_RIO2                 --------------------------------------------------
27105_Tthe_RIO_RIO2                 --------------------------------------------------
RIOK3_Hsap_RIO_RIO3                 --------------------------------------------------
RIOK3_Mmus_RIO_RIO3                 --------------------------------------------------
RIO3_Spur_RIO_RIO3                  --------------------------------------------------
AqueK051_Aque_RIO_RIO3              --------------------------------------------------
CG3008_Dmel_RIO_RIO3                --------------------------------------------------
ZK632.3_Cele_RIO_RIO3               --------------------------------------------------
RIOK1_Hsap_RIO_RIO1                 --------------------------------------------------
RIOK1_Mmus_RIO_RIO1                 --------------------------------------------------
RIO1_Spur_RIO_RIO1                  --------------------------------------------------
RIO1-2_Smoe_RIO_RIO1                --------------------------------------------------
RIO1-1_Smoe_RIO_RIO1                --------------------------------------------------
AqueK049_Aque_RIO_RIO1              --------------------------------------------------
CG11660_Dmel_RIO_RIO1               --------------------------------------------------
Rio1_Ddis_RIO_RIO1                  --------------------------------------------------
M01B12.5_Cele_RIO_RIO1              --------------------------------------------------
CC1G_04984_Ccin_RIO_RIO1            --------------------------------------------------
RIO1_Scer_RIO_RIO1                  --------------------------------------------------
11147_Tthe_RIO_RIO1                 --------------------------------------------------
FRAP_Hsap_PIKK_FRAP                 --------------------------------------------------
FRAP_Mmus_PIKK_FRAP                 --------------------------------------------------
AqueK046_Aque_PIKK_FRAP             --------------------------------------------------
TOR_Dmel_PIKK_FRAP                  --------------------------------------------------
Tor_Ddis_PIKK_FRAP                  --------------------------------------------------
CC1G_00894_Ccin_PIKK_FRAP           --------------------------------------------------
TOR1_Scer_PIKK_FRAP                 --------------------------------------------------
TOR2_Scer_PIKK_FRAP                 --------------------------------------------------
FRAP_Smoe_PIKK_FRAP                 --------------------------------------------------
B0261.2_Cele_PIKK_FRAP              --------------------------------------------------
20618_Tthe_PI3K_PI4K                --------------------------------------------------
20619_Tthe_PI3K_PI4K                --------------------------------------------------
ATR_Mmus_PIKK_ATR                   --------------------------------------------------
ATR_Hsap_PIKK_ATR                   --------------------------------------------------
ATR_Spur_PIKK_ATR                   --------------------------------------------------
AqueK044_Aque_PIKK_ATR              --------------------------------------------------
ATR_Smoe_PIKK_ATR                   --------------------------------------------------
CC1G_08126_Ccin_PIKK_ATR            --------------------------------------------------
ATM_Mmus_PIKK_ATM                   --------------------------------------------------
ATM_Hsap_PIKK_ATM                   --------------------------------------------------
ATM_Smoe_PIKK_ATM                   --------------------------------------------------
AqueK043_Aque_PIKK_ATM              --------------------------------------------------
ATMa_Spur_PIKK_ATM                  --------------------------------------------------
n737_Tthe_PI3K_PI4K                 --------------------------------------------------
n858_Tthe_PI3K_PI4K                 --------------------------------------------------
n8_Tthe_PI3K_PI4K                   --------------------------------------------------
n73_Tthe_PI3K_PI4K                  --------------------------------------------------
n545_Tthe_PI3K_PI4K                 --------------------------------------------------
n502_Tthe_PI3K_PI4K                 --------------------------------------------------
n508_Tthe_PI3K_PI4K                 --------------------------------------------------
n131_Tthe_PI3K_PI4K                 --------------------------------------------------
DNAPK_Mmus_PIKK_DNAPK               QALQISLVFSRDFGLLVFIRKS--------------LSIEDFRDCREEAL
DNAPK_Hsap_PIKK_DNAPK               LALQTSLVFSRDFGLLVFVRKS--------------LNSIEFRECREEIL
DNAPK_Spur_PIKK_DNAPK               --------------------------------------------------
AqueK045_Aque_PIKK_DNAPK            --------------------------------------------------
DNAPK_Smoe_PIKK_DNAPK               --------------------------------------------------
DNAPK_Ddis_PIKK_DNAPK               SIILKELVLEEEIGLVASLLFTGDHSLLKYLEKSSTISNKENVKIKVSIL
ADCK1_Mmus_ABC1_ABC1-B              --------------------------------------------------
ADCK1_Hsap_ABC1_ABC1-B              --------------------------------------------------
ADCK1_Spur_ABC1_ABC1-B              --------------------------------------------------
CG3608_Dmel_ABC1_ABC1-B             --------------------------------------------------
D2023.6_Cele_ABC1_ABC1-B            --------------------------------------------------
AqueK029_Aque_ABC1_ABC1-B           --------------------------------------------------
ABC1-B_b_Smoe_ABC1_ABC1-B           --------------------------------------------------
YLR253W_Scer_ABC1_ABC1-B            --------------------------------------------------
CC1G_14173_Ccin_ABC1_ABC1-B         --------------------------------------------------
ADCK5_Mmus_ABC1_ABC1-D              --------------------------------------------------
ADCK5_Hsap_ABC1_ABC1-D              --------------------------------------------------
AqueK031_Aque_ABC1_ABC1-D           --------------------------------------------------
ADCK5_Spur_ABC1_ABC1-D              --------------------------------------------------
CG7616_Dmel_ABC1_ABC1-D             --------------------------------------------------
AdckB2_Ddis_ABC1_ABC1-D             --------------------------------------------------
ABC1-B_a_Smoe_ABC1_ABC1-B           --------------------------------------------------
14263_Tthe_ABC1_ABC1-B              --------------------------------------------------
CC1G_15805_Ccin_ABC1_ABC1-B         --------------------------------------------------
ABC1-B-p1_b-1_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_b-2_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_a-2_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-B-p1_a-1_Smoe_ABC1_ABC1-B      --------------------------------------------------
ABC1-D_b_Smoe_ABC1_ABC1-D           --------------------------------------------------
ABC1-D_a_Smoe_ABC1_ABC1-D           --------------------------------------------------
ABC1-E_b_Smoe_ABC1_ABC1-E           --------------------------------------------------
ABC1-E_a_Smoe_ABC1_ABC1-E           --------------------------------------------------
ABC1-F_d_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_e_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_a_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_b_Smoe_ABC1_ABC1-F           --------------------------------------------------
ABC1-F_c_Smoe_ABC1_ABC1-F           --------------------------------------------------
ADCK2_Mmus_ABC1_ABC1-C              --------------------------------------------------
ADCK2_Hsap_ABC1_ABC1-C              --------------------------------------------------
ADCK2_Spur_ABC1_ABC1-C              --------------------------------------------------
AqueK030_Aque_ABC1_ABC1-C           --------------------------------------------------
YPL109C_Scer_ABC1_ABC1-C            --------------------------------------------------
CC1G_01824_Ccin_ABC1_ABC1-C         --------------------------------------------------
ABC1-C-1_Smoe_ABC1_ABC1-C           --------------------------------------------------
ABC1-C-2_Smoe_ABC1_ABC1-C           --------------------------------------------------
AdckC_Ddis_ABC1_ABC1-C              --------------------------------------------------
ADCK4_Mmus_ABC1_ABC1-A              --------------------------------------------------
ADCK4_Hsap_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Mmus_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Hsap_ABC1_ABC1-A              --------------------------------------------------
ADCK3_Spur_ABC1_ABC1-A              --------------------------------------------------
AqueK028_Aque_ABC1_ABC1-A           --------------------------------------------------
CG4410_Dmel_ABC1_ABC1-A             --------------------------------------------------
ABC1-A_Smoe_ABC1_ABC1-A             --------------------------------------------------
C35D10.4_Cele_ABC1_ABC1-A           --------------------------------------------------
AdckA_Ddis_ABC1_ABC1-A              --------------------------------------------------
ABC1_Scer_ABC1_ABC1-A               --------------------------------------------------
CC1G_11046_Ccin_ABC1_ABC1-A         --------------------------------------------------
30099_Tthe_ABC1_ABC1-A              --------------------------------------------------
BCR_Mmus_BCR                        --------------------------------------------------
BCR_Hsap_BCR                        --------------------------------------------------
ABR_Hsap_BCR                        --------------------------------------------------
ABR_Mmus_BCR                        --------------------------------------------------
BCR_Spur_BCR                        --------------------------------------------------
BLVRA_Hsap_BLVRA                    --------------------------------------------------
BLVRA_Mmus_BLVRA                    --------------------------------------------------
TAF1_Hsap_TAF1                      --------------------------------------------------
TAF1_Mmus_TAF1                      --------------------------------------------------
TAF1L_Hsap_TAF1                     --------------------------------------------------
TAF1_Spur_TAF1                      --------------------------------------------------
Taf250_Dmel_TAF1                    --------------------------------------------------
AqueK052_Aque_TAF1                  --------------------------------------------------
taf-1_Cele_TAF1                     --------------------------------------------------
TAF1-1_Smoe_TAF1                    --------------------------------------------------
TAF1-2_Smoe_TAF1                    --------------------------------------------------
G11_Hsap_G11                        --------------------------------------------------
G11_Mmus_G11                        --------------------------------------------------
G11_Spur_G11                        --------------------------------------------------
TIF1g_Hsap_TIF1                     --------------------------------------------------
TIF1g_Mmus_TIF1                     --------------------------------------------------
TIF1a_Hsap_TIF1                     --------------------------------------------------
TIF1a_Mmus_TIF1                     --------------------------------------------------
TIF1b_Hsap_TIF1                     --------------------------------------------------
TIF1b_Mmus_TIF1                     --------------------------------------------------
TIF1D_Hsap_TIF1                     --------------------------------------------------
TIF1D_Mmus_TIF1                     --------------------------------------------------
GTF2F1_Hsap_GTF2F1                  --------------------------------------------------
GTF2F1_Mmus_GTF2F1                  --------------------------------------------------
BAZ1A_Hsap_BAZ                      --------------------------------------------------
BAZ1A_Mmus_BAZ                      --------------------------------------------------
BAZ1B_Hsap_BAZ                      --------------------------------------------------
BAZ1B_Mmus_BAZ                      --------------------------------------------------
FASTK_Hsap_FAST                     --------------------------------------------------
FASTK_Mmus_FAST                     --------------------------------------------------
AlphaK3_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK3_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK2_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK2_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
CC1G_14582_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_06337_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_07428_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_08873_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_12594_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_02529_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_10953_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_00657_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_11146_Ccin_Alpha_Alpha-Un      --------------------------------------------------
eEF2K_Mmus_Alpha_eEF2K              --------------------------------------------------
eEF2K_Hsap_Alpha_eEF2K              --------------------------------------------------
eEF2K_Spur_Alpha_eEF2K              --------------------------------------------------
AqueK040_Aque_Alpha_eEF2K           --------------------------------------------------
efk-1_Cele_Alpha_eEF2K              --------------------------------------------------
MHCK-A_Ddis_Alpha_MHCK              --------------------------------------------------
MHCK-B_Ddis_Alpha_MHCK              --------------------------------------------------
ChaK2_Mmus_Alpha_ChaK               --------------------------------------------------
ChaK2_Hsap_Alpha_ChaK               --------------------------------------------------
ChaK1_Mmus_Alpha_ChaK               --------------------------------------------------
ChaK1_Hsap_Alpha_ChaK               --------------------------------------------------
AqueK032_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK036_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK039_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK033_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK037_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK034_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK035_Aque_Alpha_Alpha-spon      --------------------------------------------------
AqueK038_Aque_Alpha_Alpha-spon      --------------------------------------------------
15769_Tthe_Alpha_VWL                --------------------------------------------------
15771_Tthe_Alpha_VWL                --------------------------------------------------
25428_Tthe_Alpha_VWL                --------------------------------------------------
6257_Tthe_Alpha_VWL                 --------------------------------------------------
6258_Tthe_Alpha_VWL                 --------------------------------------------------
24053_Tthe_Alpha_VWL                --------------------------------------------------
29299_Tthe_Alpha_VWL                --------------------------------------------------
7218_Tthe_Alpha_VWL                 --------------------------------------------------
AlphaK1_Mmus_Alpha_Alpha-Uncla      --------------------------------------------------
AlphaK1_Hsap_Alpha_Alpha-Uncla      --------------------------------------------------
BRDT_Mmus_BRD                       --------------------------------------------------
BRDT_Hsap_BRD                       --------------------------------------------------
BRD4_Mmus_BRD                       --------------------------------------------------
BRD4_Hsap_BRD                       --------------------------------------------------
BRD3_Mmus_BRD                       --------------------------------------------------
BRD3_Hsap_BRD                       --------------------------------------------------
BRD2_Mmus_BRD                       --------------------------------------------------
BRD2_Hsap_BRD                       --------------------------------------------------
BRD_Spur_BRD                        --------------------------------------------------
AqueK041_Aque_BRD                   --------------------------------------------------
Y32H12A.7_Cele_ABC1_ABC1-C          --------------------------------------------------
17202_Tthe_HisK                     --------------------------------------------------
4146_Tthe_HisK                      --------------------------------------------------
7982_Tthe_HisK                      --------------------------------------------------
GK010_Glam_RIO_RIO1                 --------------------------------------------------
14574_Tthe_HisK                     --------------------------------------------------
smg-1_Cele_PIKK_SMG1                --------------------------------------------------
AdckB1_Ddis_ABC1_ABC1-B             --------------------------------------------------
MHCK-C_Ddis_Alpha_MHCK              --------------------------------------------------
26487_Tthe_HisK                     --------------------------------------------------
13283_Tthe_HisK                     --------------------------------------------------
16249_Tthe_HisK                     --------------------------------------------------
28479_Tthe_HisK                     --------------------------------------------------
RhoGAP1A_Dmel_BCR                   --------------------------------------------------
ABC1-G_Smoe_ABC1_ABC1-G             --------------------------------------------------
DhkA_Ddis_HisK                      --------------------------------------------------
DhkK_Ddis_HisK                      --------------------------------------------------
23657_Tthe_ABC1_ABC1-B              --------------------------------------------------
17204_Tthe_HisK                     --------------------------------------------------
17203_Tthe_HisK                     --------------------------------------------------
HisK_a_Smoe_HisK                    --------------------------------------------------
atm-1_Cele_PIKK_ATM                 --------------------------------------------------
Y119C1B.8_Cele_BRD                  --------------------------------------------------
DhkL_Ddis_HisK                      --------------------------------------------------
DokA_Ddis_HisK                      --------------------------------------------------
MHCK-D_Ddis_Alpha_MHCK              --------------------------------------------------
21169_Tthe_HisK                     --------------------------------------------------
22236_Tthe_HisK                     --------------------------------------------------
FRAP_Spur_PIKK_FRAP                 --------------------------------------------------
SMG1_Smoe_PIKK_SMG1                 --------------------------------------------------
mei-41_Dmel_PIKK_ATR                --------------------------------------------------
5266_Tthe_HisK                      --------------------------------------------------
CC1G_00331_Ccin_PIKK_TRRAP          --------------------------------------------------
TRA1_Scer_PIKK_TRRAP                --------------------------------------------------
CG6535_Dmel_PIKK_ATM                --------------------------------------------------
DhkB_Ddis_HisK                      --------------------------------------------------
DhkC_Ddis_HisK                      --------------------------------------------------
DhkE_Ddis_HisK                      --------------------------------------------------
DhkH_Ddis_HisK                      --------------------------------------------------
TAF1_Ddis_TAF1                      --------------------------------------------------
12346_Tthe_HisK                     --------------------------------------------------
16839_Tthe_HisK                     --------------------------------------------------
15614_Tthe_HisK                     --------------------------------------------------
5265_Tthe_HisK                      --------------------------------------------------
7183_Tthe_HisK                      --------------------------------------------------
13773_Tthe_PI3K_PI4K                --------------------------------------------------
AqueK042_Aque_HisK                  --------------------------------------------------
ABC1-B-p1_d_Smoe_ABC1_ABC1-B-p      --------------------------------------------------
ABC1-B-p1_c_Smoe_ABC1_ABC1-B-p      --------------------------------------------------
ATR_Ddis_PIKK_ATR                   --------------------------------------------------
DhkD_Ddis_HisK                      --------------------------------------------------
DhkF_Ddis_HisK                      --------------------------------------------------
DhkM_Ddis_HisK                      --------------------------------------------------
SMG1_Ddis_PIKK_SMG1                 --------------------------------------------------
VwkA_Ddis_Alpha_VWL                 --------------------------------------------------
11424_Tthe_HisK                     --------------------------------------------------
6390_Tthe_HisK                      --------------------------------------------------
12733_Tthe_HisK                     --------------------------------------------------
15795_Tthe_HisK                     --------------------------------------------------
15969_Tthe_HisK                     --------------------------------------------------
16246_Tthe_HisK                     --------------------------------------------------
13303_Tthe_HisK                     --------------------------------------------------
19275_Tthe_HisK                     --------------------------------------------------
8067_Tthe_HisK                      --------------------------------------------------
8442_Tthe_HisK                      --------------------------------------------------
F13C5.2_Cele_BRD                    --------------------------------------------------
HisK_q_Smoe_HisK                    --------------------------------------------------
C47D12.1_Cele_PIKK_TRRAP            --------------------------------------------------
TAF1_Scer_TAF1                      --------------------------------------------------
CC1G_13701_Ccin_TAF1                --------------------------------------------------
YIL042C_Scer_PDHK_PDHK              --------------------------------------------------
17637_Tthe_ABC1_ABC1-B              --------------------------------------------------
15326_Tthe_HisK                     --------------------------------------------------
16029_Tthe_HisK                     --------------------------------------------------
19671_Tthe_HisK                     --------------------------------------------------
22059_Tthe_HisK                     --------------------------------------------------
22277_Tthe_HisK                     --------------------------------------------------
30008_Tthe_HisK                     --------------------------------------------------
3312_Tthe_HisK                      --------------------------------------------------
6037_Tthe_HisK                      --------------------------------------------------
7076_Tthe_HisK                      --------------------------------------------------
7838_Tthe_HisK                      --------------------------------------------------
7820_Tthe_HisK                      --------------------------------------------------
F57C7.1b_Cele_BRD                   --------------------------------------------------
bon_Dmel_TIF1                       --------------------------------------------------
SLN1_Scer_HisK                      --------------------------------------------------
MEC1_Scer_PIKK_ATR                  --------------------------------------------------
G11_Ddis_G11                        --------------------------------------------------
13539_Tthe_HisK                     --------------------------------------------------
15301_Tthe_HisK                     --------------------------------------------------
17211_Tthe_HisK                     --------------------------------------------------
17212_Tthe_HisK                     --------------------------------------------------
17177_Tthe_HisK                     --------------------------------------------------
19862_Tthe_HisK                     --------------------------------------------------
14296_Tthe_HisK                     --------------------------------------------------
23233_Tthe_HisK                     --------------------------------------------------
2892_Tthe_HisK                      --------------------------------------------------
19891_Tthe_HisK                     --------------------------------------------------
22114_Tthe_HisK                     --------------------------------------------------
25571_Tthe_HisK                     --------------------------------------------------
28692_Tthe_HisK                     --------------------------------------------------
29191_Tthe_HisK                     --------------------------------------------------
3209_Tthe_HisK                      --------------------------------------------------
4106_Tthe_HisK                      --------------------------------------------------
TIF1_Spur_TIF1                      --------------------------------------------------
n29_Tthe_PI3K_PI4K                  --------------------------------------------------
n679_Tthe_PI3K_PI4K                 --------------------------------------------------
CC1G_06302_Ccin_PIKK_PI3K           --------------------------------------------------
CC1G_00839_Ccin_PIKK_ATM            --------------------------------------------------
10338_Tthe_Alpha_Alpha-Unclass      --------------------------------------------------
ak1_Ddis_Alpha_Alpha-Unclassif      --------------------------------------------------
10472_Tthe_HisK                     --------------------------------------------------
1075_Tthe_HisK                      --------------------------------------------------
12411_Tthe_HisK                     --------------------------------------------------
18664_Tthe_HisK                     --------------------------------------------------
11754_Tthe_HisK                     --------------------------------------------------
21980_Tthe_HisK                     --------------------------------------------------
22113_Tthe_HisK                     --------------------------------------------------
22136_Tthe_HisK                     --------------------------------------------------
22512_Tthe_HisK                     --------------------------------------------------
26654_Tthe_HisK                     --------------------------------------------------
5989_Tthe_HisK                      --------------------------------------------------
ABC1-H_Smoe_ABC1_ABC1-H             --------------------------------------------------
HisK_j_Smoe_HisK                    --------------------------------------------------
HisK_n_Smoe_HisK                    --------------------------------------------------
TRRAP_Ddis_PIKK_TRRAP               --------------------------------------------------
4594_Tthe_HisK                      --------------------------------------------------
6859_Tthe_HisK                      --------------------------------------------------
6877_Tthe_HisK                      --------------------------------------------------
TEL1_Scer_PIKK_ATM                  --------------------------------------------------
CC1G_14302_Ccin_Alpha_Alpha-Un      --------------------------------------------------
CC1G_14422_Ccin_HisK                --------------------------------------------------
DDB0220693_Ddis_BRD                 --------------------------------------------------
n566_Tthe_HisK                      --------------------------------------------------
n573_Tthe_CAK                       --------------------------------------------------
n558_Tthe_CAK                       --------------------------------------------------
n623_Tthe_CAK                       --------------------------------------------------
29569_Tthe_PI3K_PI4K                --------------------------------------------------
DDB0220694_Ddis_BRD                 --------------------------------------------------
15306_Tthe_HisK                     --------------------------------------------------
n619_Tthe_HisK                      --------------------------------------------------
CC1G_13883_Ccin_PIKK_PI4K           --------------------------------------------------
CC1G_04234_Ccin_PIKK_PI4K           --------------------------------------------------
n596_Tthe_PI3_PI4                   --------------------------------------------------
CC1G_02967_Ccin_HisK                --------------------------------------------------
atl-1_Cele_PIKK_ATR                 --------------------------------------------------
6605_Tthe_TAF1                      --------------------------------------------------
CC1G_05545_Ccin_HisK                --------------------------------------------------
HisK_o_Smoe_HisK                    --------------------------------------------------


TRRAP_Hsap_PIKK_TRRAP               ----