Gene LRR36_n (S.moellendorffii)
LRR36_n
Species: S.moellendorffii
Alias: LRR36_n
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| LRR36_n.AA | Protein | None | 91 | None | Fasta, JSON |
| LRR36_n.NA | RNA | None | 276 | None | Fasta, JSON |
| LRR36_n.kin_dom | Protein Kinase Domain | None | 35 | None | Fasta, JSON |
Protein domains of LRR36_n.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | LRR36_n.AA | Meta | 6-38 | 57 | 7.8e-17 | 45.09 | In-house | 142-174 (287) | Show / Hide |
Range on Protein: 6-38 Range on HMM: 142-174/287 Sequence Identity: 57% (19 aa) QKVIHGDIKPENLMITAEGRIKIGDFGISRTFE ||.|| ||||.|| .. .| .|| |||.| || QKIIHRDIKPSNLLLNDDGHVKIADFGVSNEFE |
|||||||||
| Kinase | LRR36_n.AA | Aur | 5-32 | 51 | 5.3e-15 | 35.51 | In-house | 119-147 (257) | Show / Hide |
Range on Protein: 5-32 Range on HMM: 119-147/257 Sequence Identity: 51% (15 aa) RQKVIHGDIKPENLMIT-AEGRIKIGDFG ....|| ||||||... .| |||.||| SKNIIHRDIKPENILLDQCNGNIKICDFG |
|||||||||
| Kinase | LRR36_n.AA | CDC2 | 5-40 | 44 | 6e-15 | 41.86 | In-house | 121-156 (301) | Show / Hide |
Range on Protein: 5-40 Range on HMM: 121-156/301 Sequence Identity: 44% (16 aa) RQKVIHGDIKPENLMITAEGRIKIGDFGISRTFEVP .....| |.|| |. | ..|.|||.|||..|.| .| QRRIMHRDLKPQNILIDKKGNIKIADFGLARAFGIP |
|||||||||
| Kinase | LRR36_n.AA | AGC | 5-34 | 40 | 8.3e-14 | 30.6 | In-house | 171-202 (395) | Show / Hide |
Range on Protein: 5-34 Range on HMM: 171-202/395 Sequence Identity: 40% (13 aa) R-QKVIHGD-IKPENLMITAEGRIKIGDFGIS . ...|| | .||||......| ||. ||| . SHMGIIHRDYLKPENILLDEDGHIKLTDFGLC |
|||||||||
| Kinase | LRR36_n.AA | CDK | 5-41 | 31 | 6.6e-13 | 37.47 | In-house | 126-173 (284) | Show / Hide |
Range on Protein: 5-41 Range on HMM: 126-173/284 Sequence Identity: 31% (15 aa) RQKVIHGDIKPENLMITAEGR-----IKIGDFGISRTFEV------PQ .....| |.|| |..|. | .||.||| .| | . |. SNWIMHRDLKPQNILINNNGEVKCGRLKIADFGLARAFGIPHQMSEPN |
|||||||||
| Kinase | LRR36_n.AA | CMGC | 3-41 | 26 | 6.7e-13 | 37.79 | In-house | 198-258 (513) | Show / Hide |
Range on Protein: 3-41 Range on HMM: 198-258/513 Sequence Identity: 26% (16 aa) INRQK--VIHGDIKPENLMITAE--------------------GRIKIGDFGISRTFEVPQ . ... .|| |.||||..|. . ||.||.||| .| ..... CHSHWGNIIHRDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFGLARWYHPHS |
|||||||||
| Kinase | LRR36_n.AA | CAMKK | 4-38 | 36 | 5.7e-12 | 33.82 | In-house | 194-250 (396) | Show / Hide |
Range on Protein: 4-38 Range on HMM: 194-250/396 Sequence Identity: 36% (21 aa) NRQK-------------------VIHGDIKPENLMITAEG---RIKIGDFGISRTFE | || .|| ||||.|. |. || ..|| |||.| || NYQKACSYIIIYINEFIIDHFQDIIHRDIKPQNILIDEEGCGEHVKIADFGVSHIFE |
|||||||||
| Kinase | LRR36_n.AA | Ciliate-E2b | 4-38 | 37 | 1.1e-11 | 31.92 | In-house | 119-153 (272) | Show / Hide |
Range on Protein: 4-38 Range on HMM: 119-153/272 Sequence Identity: 37% (13 aa) NRQKVIHGDIKPENLMITAEGRIKIGDFGISRTFE . |..|..|||||| |.. .| .|. |.|.. ... HNQNIIYRDIKPENIMVDHKGYMKLIDMGTAKHMY |
|||||||||
| Kinase | LRR36_n.AA | CAMKL | 5-46 | 35 | 1.7e-11 | 32.81 | In-house | 145-195 (297) | Show / Hide |
Range on Protein: 5-46 Range on HMM: 145-195/297 Sequence Identity: 35% (18 aa) RQKVIHGDIKPENLMITAEG--RIKIGDFGISRTFE-V----PQ--SLWCG .....| ||||||.... | ||| ||| | .. . | . .|| SHGIVHRDIKPENILLDENGNNNIKIIDFGFSNMYRPCIFGPGQKLKTFCG |
|||||||||
| Kinase | LRR36_n.AA | NEK | 5-38 | 42 | 3.5e-11 | 36.0 | In-house | 137-174 (286) | Show / Hide |
Range on Protein: 5-38 Range on HMM: 137-174/286 Sequence Identity: 42% (16 aa) RQKVIHGDIKPENLMITAEGR----IKIGDFGISRTFE ..|..| |||| |...|.... .||||||||. .. QRKILHRDIKPQNIFLTKNNNDYHNVKIGDFGISKVLN |
|||||||||
| Kinase | LRR36_n.AA | Pkinase | 5-42 | 39 | 1.4e-09 | 34.98 | Pfam | 126-167 (293) | Show / Hide |
Range on Protein: 5-42 Range on HMM: 126-167/293 Sequence Identity: 39% (17 aa) RQKVIHGDIKPENLMITAEGRI----KIGDFGISRTF-EVPQS ....|| |.||||..| .| | ||.|||... | . ..| SMGIIHRDLKPENILIDNNGHIDACVKICDFGLAKQFDY-NNS |
|||||||||