Gene TVAG_185120 (T.vaginalis)
TVAG_185120
Species: T.vaginalis
Alias: TVAG_185120, TvagK1054
External Links:
Annotation:
Group:
CMGC
Family:
CMGC-Tvag1
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| TVAG_185120.AA | Protein | None | 866 | None | Fasta, JSON |
| TVAG_185120.kin_dom | Protein Kinase Domain | None | 249 | None | Fasta, JSON |
Protein domains of TVAG_185120.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | TVAG_185120.AA | CDKL | 164-201 | 44 | 0.00033 | 10.29 | In-house | 182-218 (286) | Show / Hide |
Range on Protein: 164-201 Range on HMM: 182-218/286 Sequence Identity: 44% (17 aa) DCWAIGAMLCEYLIYGHPIFMSSSDTDQMLITQTILGP | |||| .. | .| |.|.. ..|| ||. | ||| DIWAIGCVMAE-MIDGQPLWPGQSDIDQLYHIQKCLGP |
|||||||||