Gene TVAG_244150 (T.vaginalis)
TVAG_244150
Species: T.vaginalis
Alias: TvagK1060, TVAG_244150
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| TVAG_244150.AA | Protein | None | 98 | None | Fasta, JSON |
| TVAG_244150.kin_dom | Protein Kinase Domain | None | 28 | None | Fasta, JSON |
Protein domains of TVAG_244150.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | TVAG_244150.AA | S_TK_X | 29-89 | 32 | 3.2e-17 | 64.46 | SMART | 1-79 (79) | Show / Hide |
Range on Protein: 29-89 Range on HMM: 1-79/79 Sequence Identity: 32% (28 aa) NGIDWDKVLT--KSYVPSYKPPIK----SKKDVSNFDQEFTAEPAMDSVGSVAPTPIQR-------------------IADFSYVA ||||||.. | . | .||.|| | |.||||.||| |..| ||... ..|.||. RGIDWDKLYNQQKEIEPPFKPKIKEVYASPTDTSNFDPEFTEETPM-------LTPDDPPLSNSMWQNEMETEIPPDPFRGFTYVF |
|||||||||
| Kinase | TVAG_244150.AA | Pkinase_C | 48-91 | 36 | 1.6e-08 | 33.32 | Pfam | 1-46 (46) | Show / Hide |
Range on Protein: 48-91 Range on HMM: 1-46/46 Sequence Identity: 36% (17 aa) PIKSKKDVSNFDQEFTAEPAMDSV---GSVAPTPIQRIADFSYVASL .||. |.|||| ||| ||.||.. . .|.||.. QVKSPTDTSNFDPEFTDEPPMDTPPDWR-MSSGDQEPFRGFTYVNPD |
|||||||||
| Kinase | TVAG_244150.AA | AGC | 3-28 | 33 | 8.8e-08 | 14.65 | In-house | 360-395 (395) | Show / Hide |
Range on Protein: 3-28 Range on HMM: 360-395/395 Sequence Identity: 33% (12 aa) SLITGLLQKRDRKRYA----------YEDIIKHPFF .||..||.| .|| .|.| .||.| DLIKKLLCKDPEKRLGCGGNDFGDKGAEEIKNHPWF |
|||||||||
| Kinase | TVAG_244150.AA | DMPK | 15-28 | 57 | 2e-06 | 11.01 | In-house | 257-270 (270) | Show / Hide |
Range on Protein: 15-28 Range on HMM: 257-270/270 Sequence Identity: 57% (8 aa) KRYAYEDIIKHPFF .|. |||. .|||| GRNGYEDFKCHPFF |
|||||||||
| Kinase | TVAG_244150.AA | CAMK | 3-28 | 34 | 5e-06 | 14.72 | In-house | 400-425 (425) | Show / Hide |
Range on Protein: 3-28 Range on HMM: 400-425/425 Sequence Identity: 34% (9 aa) SLITGLLQKRDRKRYAYEDIIKHPFF .|| ..||. ||. |.. .||.. DLIRKMLQVDPEKRMTIEQCLNHPWM |
|||||||||
| Kinase | TVAG_244150.AA | CAMKL | 3-28 | 34 | 6e-06 | 14.7 | In-house | 272-297 (297) | Show / Hide |
Range on Protein: 3-28 Range on HMM: 272-297/297 Sequence Identity: 34% (9 aa) SLITGLLQKRDRKRYAYEDIIKHPFF .|| ..||. ||. ..| .||.. DLIRKMLQVNPEKRPTIHQIMNHPWM |
|||||||||
| Kinase | TVAG_244150.AA | AMPK | 3-28 | 42 | 8e-06 | 13.41 | In-house | 229-254 (254) | Show / Hide |
Range on Protein: 3-28 Range on HMM: 229-254/254 Sequence Identity: 42% (11 aa) SLITGLLQKRDRKRYAYEDIIKHPFF .|| ..||. ||. .|| .||.| DLIKHMLQVDPMKRITIHDIRNHPWF |
|||||||||
| Kinase | TVAG_244150.AA | Ciliate-E2 | 4-28 | 40 | 1.1e-05 | 15.46 | In-house | 336-365 (365) | Show / Hide |
Range on Protein: 4-28 Range on HMM: 336-365/365 Sequence Identity: 40% (12 aa) LITG----LLQKRDRKRYA-YEDIIKHPFF || .||| ||. .|.|..||.| LIKKFGKRMLQKDPEKRITGWEQILNHPWF |
|||||||||
| Kinase | TVAG_244150.AA | Ciliate-E2a | 4-28 | 32 | 1.1e-05 | 12.68 | In-house | 251-275 (275) | Show / Hide |
Range on Protein: 4-28 Range on HMM: 251-275/275 Sequence Identity: 32% (8 aa) LITGLLQKRDRKRYAYEDIIKHPFF |. ..|.| ||. ... .||.| LMKKMLEKDPKKRITAQQALNHPWF |
|||||||||
| Kinase | TVAG_244150.AA | SGK | 2-28 | 45 | 1.4e-05 | 12.73 | In-house | 253-283 (283) | Show / Hide |
Range on Protein: 2-28 Range on HMM: 253-283/283 Sequence Identity: 45% (14 aa) CSLITGLLQKRDRKRYAYE----DIIKHPFF ..||.||||| .|| .| .|||| WDLIQGLLQKDPKKRLGTKRDFMEIKNHPFF |
|||||||||
| Kinase | TVAG_244150.AA | ULK | 1-28 | 32 | 1.8e-05 | 15.18 | In-house | 302-329 (329) | Show / Hide |
Range on Protein: 1-28 Range on HMM: 302-329/329 Sequence Identity: 32% (9 aa) VCSLITGLLQKRDRKRYAYEDIIKHPFF . .|| ..||. ..| |....||.| CKDLIRRMLQYDEKDRISWEELFNHPWF |
|||||||||
| Kinase | TVAG_244150.AA | ULK | 1-28 | 35 | 3.2e-05 | 14.57 | In-house | 297-324 (324) | Show / Hide |
Range on Protein: 1-28 Range on HMM: 297-324/324 Sequence Identity: 35% (10 aa) VCSLITGLLQKRDRKRYAYEDIIKHPFF . .|| ..||. ..| |.|..||.| CKDLIRRMLQYDEKDRISWEEIFNHPWF |
|||||||||