Gene GL50803_16587 (G.lamblia)
GL50803_16587
Group:
Other
Family:
Other-Unique
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_16587.AA | Protein | None | 307 | None | Fasta, JSON |
| GL50803_16587.kin_dom | Protein Kinase Domain | None | 266 | None | Fasta, JSON |
Protein domains of GL50803_16587.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | GL50803_16587.AA | S_TKc | 9-301 | 13 | 6.2e-09 | -45.95 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 9-301
Range on HMM: 1-231/231
Sequence Identity: 13% (43 aa)
YEVSEFLGYGNTGTVYKAQSTCSEAECSPSFVALKIASKTQRDHECTGNPFAKEFDLLAAMHAANPACFVRPLGCGTTENVHFLATELMDE---TLDRWG
||. . .| | |.|||.. . . ||.|| . . . .| ..| . |. ... . . .. .|..| .| .
YEILRKIGKGAFGKVYKCRHKK-----TGRIVAIKIIK----------EHIRREIQILKK----HHPNIVKLYDVFQD-DHLYMVMEYCDGDLGDLFDYI
ERLRPMLV-SGLTDKVAVTILSKLRSTIDALATAHALGYSIRDISPRNFLVKDDVAKAIDLSSAIFITCDTVHPDTRVTPRYASSNVVVGGKAQYSD---
.. .. .... .| . .. ...||. | .| ||. | | |. . . | .| .| .. .|| | . |. .|.
KKRGRHGLRFPFPE-HARFY---MYQICCALEYCHSHGIIHRDLKPENILLDE-HIKICDFGLARQL------TTFCGTPWYMAPEVL-----GYGKCKC
--------DYEALC--YLWLDILTDRLAWRKCKKPSLIREIKLACLDAFTEYYGNLPPLFTSMLRLARNDEEQHDSKDYHKRLVDLVDELQPSDLACIVL
|| || .. .. . ..|.. . | ... . |.. .
DWWSCGCILYEMLCGYPPFP---QMQMMFKKIG-------------------------------------------SPEAKDFIRKCLQKDPEKRPTA-E
DFK----DNSSAFV
.. .. ..
ALQDEWDIKCHPWF
|
|||||||||
| Kinase | GL50803_16587.AA | STE20 | 9-26 | 55 | 0.00068 | 10.46 | In-house | 1-18 (288) | Show / Hide |
Range on Protein: 9-26 Range on HMM: 1-18/288 Sequence Identity: 55% (10 aa) YEVSEFLGYGNTGTVYKA || | .| |..|.|||| YELLEKIGQGSYGKVYKA |
|||||||||
| Kinase | GL50803_16587.AA | Fused | 9-27 | 57 | 0.000918 | 8.57 | In-house | 1-19 (251) | Show / Hide |
Range on Protein: 9-27 Range on HMM: 1-19/251 Sequence Identity: 57% (11 aa) YEVSEFLGYGNTGTVYKAQ | ||| .| | | ||||. YHVSEMVGQGSFGCVYKAR |
|||||||||
| Kinase | GL50803_16587.AA | Worm5 | 9-24 | 43 | 0.005589 | 4.9 | In-house | 1-16 (260) | Show / Hide |
Range on Protein: 9-24 Range on HMM: 1-16/260 Sequence Identity: 43% (7 aa) YEVSEFLGYGNTGTVY |.... || | ||.| YYIIYVLGEGEYGTIY |
|||||||||
| Kinase | GL50803_16587.AA | Worm5 | 188-214 | 40 | 0.006119 | 4.78 | In-house | 185-211 (260) | Show / Hide |
Range on Protein: 188-214 Range on HMM: 185-211/260 Sequence Identity: 40% (11 aa) SSNVVVGGKAQYSDDYEALCYLWLDIL | || .|| .||.| . || | .. SWNVHCGGIPRKKDDFESMMYLALRMS |
|||||||||