Gene GL50803_4977 (G.lamblia)
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_4977.AA | Protein | None | 385 | None | Fasta, JSON |
| GL50803_4977.kin_dom | Protein Kinase Domain | None | 322 | None | Fasta, JSON |
Protein domains of GL50803_4977.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| S_TKc | GL50803_4977.AA | S_TKc | 30-353 | 12 | 1.8e-08 | -52.64 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 30-353
Range on HMM: 1-231/231
Sequence Identity: 12% (45 aa)
YTRKALLHKGSDVSLYLTVLTTSMEQVISKEIYYQEENEDLVFALTDELRYISYMNNRCLQPILDVFFQRPEKRIIAVYASVNG--LSLRQIITYNTKHN
|. .. ||. . |. . . . ..| |.| . |.. . . . ..||| ... | ..| .|...| . .|
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK---------EHIRREIQILKK-HHPNIVKLYDVFQD---DHLYMVMEYCDGDLGDLFDYIKKRGRHG
VR--ISESDMWRIAGQLVSVLYYMHFVQSLHRLVKSAN---------------TDAFTESAREEDFAVMYRLYKNRPENFCSDDIHYKNFQLEELARVSN
| ..| . .... |... | |.| . .|| .| .| .
LRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDEHIKICDFGLARQL--------------------------------------------
HLVREKSMELYEYACQIIPILHREITPDNLIVDSAGYLVLCNANPYRVLSQEYGPYD--SPELQKFGIFSE-ATDLYSVGLVLYELLTCRKYLERSVDSH
. | . .||. .. . | .|.| .|||.|. . . .
-------------------------------------------------TTFCGTPWYMAPEVL---GYGKCKCDWWSCGCILYEMLCGYPPFP--QMQM
WCPRQLPNTLYFDGYSTHLRNLIRGLLHPDPALRPLLTDIMR-------LPRL
. . | ....||..|. ||. || .... | .
MFKKIG---------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | GL50803_4977.AA | WEE | 311-353 | 28 | 2.6e-08 | 24.05 | In-house | 246-297 (297) | Show / Hide |
Range on Protein: 311-353 Range on HMM: 246-297/297 Sequence Identity: 28% (15 aa) R---------QLPNTLYFDGYSTHLRNLIRGLLHPDPALRPLLTDIMRLPRL | |.|. ....|. |..||. .|||| .|| .... | | RQGDLSFDKNQIPFPEFDNIISQELKQLIKWMMHPDPEQRPTCQQLLQHPVL |
|||||||||
| Kinase | GL50803_4977.AA | NEK | 322-353 | 40 | 9.5e-08 | 23.78 | In-house | 255-286 (286) | Show / Hide |
Range on Protein: 322-353 Range on HMM: 255-286/286 Sequence Identity: 40% (13 aa) YSTHLRNLIRGLLHPDPALRPLLTDIMRLPRL ||. |.|||. .|..|| .|| ..|. .| . YSQDLQNLISQMLQKDPEQRPSCNQILEMPFI |
|||||||||
| Kinase | GL50803_4977.AA | NEK8 | 320-353 | 38 | 8.1e-07 | 15.36 | In-house | 245-278 (278) | Show / Hide |
Range on Protein: 320-353 Range on HMM: 245-278/278 Sequence Identity: 38% (13 aa) DGYSTHLRNLIRGLLHPDPALRPLLTDIMRLPRL |.|| .| |.. .| ||. || . || | . DHYSNEMRMLVHNCLQQDPEQRPSASQIMAMPLC |
|||||||||
| Kinase | GL50803_4977.AA | AGC | 278-353 | 16 | 1e-06 | 11.58 | In-house | 281-395 (395) | Show / Hide |
Range on Protein: 278-353
Range on HMM: 281-395/395
Sequence Identity: 16% (19 aa)
SEATDLYS--VGLVLYELLTC------------------RKYLERSVDSHWCPRQLPNTLYF---------DGYSTHLRNLIRGLLHPDPALRPL-----
. | | .| .| ..||.|| .. . .. .. . . . .. | . | ...||..||..||. |.
GKACDWWSFGLGCLMYEMLTGYPPFYGDNPQENRHPFRNPMEMFQKIMNGRYFINWKVKFPFPEDPQFPEDRWFSPEAKDLIKKLLCKDPEKRLGCGGND
-----LTDIMRLPRL
.|.. |
FGDKGAEEIKNHPWF
|
|||||||||
| Kinase | GL50803_4977.AA | NEK4 | 322-353 | 37 | 4e-06 | 18.21 | In-house | 226-257 (257) | Show / Hide |
Range on Protein: 322-353 Range on HMM: 226-257/257 Sequence Identity: 37% (12 aa) YSTHLRNLIRGLLHPDPALRPLLTDIMRLPRL ||. | ||.. .| | || . ||.. | . YSQDLQNLVYQMLEKQPTKRPSIFDIFQMPYI |
|||||||||
| Kinase | GL50803_4977.AA | Ciliate-E2-Unclassified | 230-295 | 18 | 1e-05 | 15.89 | In-house | 165-265 (352) | Show / Hide |
Range on Protein: 230-295 Range on HMM: 165-265/352 Sequence Identity: 18% (19 aa) ILHREITPDNLIVDSAG---YLVLCN----------------------ANPYRVLSQEYGPYD------SPELQKFGIFS----EATDLYSVGLVLYELL |.|| |.|.|...|. | |. .. ... ... | . .||. . . .. | .|.| .|||.| IIHRDIKPENILFDNNGKNYYIKIIDFGISKKYQQNNNCDTNQQQKMQIWKQQMMWTFCGTPNYMPQYTAPEVLQGQNYDHSKAYKCDIWSLGVILYEML T . F |
|||||||||
| Kinase | GL50803_4977.AA | MARK | 323-353 | 41 | 2e-05 | 13.89 | In-house | 232-262 (262) | Show / Hide |
Range on Protein: 323-353 Range on HMM: 232-262/262 Sequence Identity: 41% (13 aa) STHLRNLIRGLLHPDPALRPLLTDIMRLPRL |...||||. || ..| || ...||. | . SKECRNLIQRLLTVNPEERPTIEEIMKHPWM |
|||||||||
| Kinase | GL50803_4977.AA | MLK | 269-295 | 44 | 4.3e-05 | 12.53 | In-house | 195-221 (280) | Show / Hide |
Range on Protein: 269-295 Range on HMM: 195-221/280 Sequence Identity: 44% (12 aa) PELQKFGIFSEATDLYSVGLVLYELLT || | ...|.. | | | .| |||| PEVIKESTWSKGSDVWSYGVLLWELLT |
|||||||||
| Kinase | GL50803_4977.AA | NEK1 | 322-353 | 28 | 0.000122 | 12.21 | In-house | 245-276 (276) | Show / Hide |
Range on Protein: 322-353 Range on HMM: 245-276/276 Sequence Identity: 28% (9 aa) YSTHLRNLIRGLLHPDPALRPLLTDIMRLPRL ||. |..|. .. .| .|| ..| | . YSYELQSLVSQMFKRNPRHRPSVNQILERPFI |
|||||||||
| Kinase | GL50803_4977.AA | NEK | 116-150 | 26 | 0.002043 | 8.35 | In-house | 94-131 (286) | Show / Hide |
Range on Protein: 116-150 Range on HMM: 94-131/286 Sequence Identity: 26% (10 aa) LRQI---ITYNTKHNVRISESDMWRIAGQLVSVLYYMH | | | ... . ..|. |.. |... |.||| LYQKIKSIKKQKQKGKYFEEEQIWDWFIQMCLALKYMH |
|||||||||
| Kinase | GL50803_4977.AA | NEK6 | 320-344 | 48 | 0.002812 | 6.36 | In-house | 228-252 (252) | Show / Hide |
Range on Protein: 320-344 Range on HMM: 228-252/252 Sequence Identity: 48% (12 aa) DGYSTHLRNLIRGLLHPDPALRPLL | ||..||.|. .|||| .|| . DHYSEQLRQLVCMCIHPDPEWRPDI |
|||||||||
| Kinase | GL50803_4977.AA | NEK6 | 116-163 | 33 | 0.003139 | 6.2 | In-house | 86-133 (252) | Show / Hide |
Range on Protein: 116-163 Range on HMM: 86-133/252 Sequence Identity: 33% (16 aa) LRQIITYNTKHNVRISESDMWRIAGQLVSVLYYMHFVQSLHRLVKSAN . ..| . | | | .|. || | | || .|| .| || MSRMIKHFKKQKRLIPERTIWKYFVQLCSALEHMHSKRVMHRDIKPAN |
|||||||||
| Kinase | GL50803_4977.AA | AGC | 230-251 | 34 | 0.016837 | 0.68 | In-house | 175-197 (395) | Show / Hide |
Range on Protein: 230-251 Range on HMM: 175-197/395 Sequence Identity: 34% (8 aa) ILHRE-ITPDNLIVDSAGYLVLC | || . |.|. |. |.. |. IIHRDYLKPENILLDEDGHIKLT |
|||||||||
| Kinase | GL50803_4977.AA | WEE | 115-150 | 23 | 0.071001 | 2.16 | In-house | 91-128 (297) | Show / Hide |
Range on Protein: 115-150 Range on HMM: 91-128/297 Sequence Identity: 23% (9 aa) S--LRQIITYNTKHNVRISESDMWRIAGQLVSVLYYMH | | ..|..... | ...|. | | ... | ..| SNLLQFWIQQCHNWNHWLPEWMIWQILVDICQGLHHIH |
|||||||||
| Kinase | GL50803_4977.AA | NEK1 | 281-295 | 60 | 0.205674 | 0.87 | In-house | 202-216 (276) | Show / Hide |
Range on Protein: 281-295 Range on HMM: 202-216/276 Sequence Identity: 60% (9 aa) TDLYSVGLVLYELLT .| | | |||||.| SDIWSLGCVLYELCT |
|||||||||