Gene GL50803_6624 (G.lamblia)
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_6624.AA | Protein | None | 2199 | None | Fasta, JSON |
| GL50803_6624.kin_dom | Protein Kinase Domain | None | 484 | None | Fasta, JSON |
Protein domains of GL50803_6624.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | GL50803_6624.AA | AMPK | 449-516 | 36 | 5.3e-09 | 22.92 | In-house | 181-254 (254) | Show / Hide |
Range on Protein: 449-516 Range on HMM: 181-254/254 Sequence Identity: 36% (27 aa) VDVWCFGVTILYIMIGA------ARTEPLYRR-SNDVLAISQHLTPFTTDLLCGCLALDPVERYTAEDISRHPLY ||.| || ||| |... | ||.. |.. | ..|.| ||... | ||..|.| .|| || . VDIWSCGV-ILYAMLCGYLPFDDENTPTLYKKIKNGEYYIPKFLSPEAKDLIKHMLQVDPMKRITIHDIRNHPWF |
|||||||||
| Kinase | GL50803_6624.AA | S_TKc | 29-516 | 9 | 6e-09 | -45.67 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 29-516
Range on HMM: 1-231/231
Sequence Identity: 9% (51 aa)
YHILRELGSGTESSVRLGQSLQSGTQVSVYFQPLTDSRKGFTGYNGRFNYFQLLDKINVHAIPGTRRVLEIWYNKNSCIQLHKLLVCAGVTFIDSLYDTT
|.|||..|.|. ..|.... .| .| . . . . ||..| . . . ...
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK---------------------------------------EHIRREIQILKK-HHPNIVKLYDVFQD-
APLGDTDSTIARTLFLVVEYCSN------SGIQPIVGQ-----LHYSDYISFSRRLSYTIYSLHKIGIIHKDIKVDNILFNEKHLRHNELFYAEEHPLSV
|..| |||.. . |. .. .. . .. . . . .|. |||| |.| .|||..|
-----------DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE------------------
DPYLIDFGISIDLSLLNTKIITFDTM----LQGIGRLLTKDLGQ---------VTTLEWFDIEGPVYAILTKNERVERLIEIVMYYIKHFFTIESLRILA
..|||.. | .| . | . | | | .. | . . | . .........
HIKICDFGLARQL---TTFCGTPWYMAPEVL---------GYGKCKCDWWSCGCILYEMLCGYPPFP-------QMQMMFKKIG----------------
DPLISSNEKFITNKNGTIAYLPPELSCEDLHTSICDRPGSTIKTHEQATCALAEVSVLPRCSTHPRCNSFKFNRDTRSCNLCTRHETSSHEEDALESDHM
----------------------------------------------------------------------------------------------------
VSQATLIKSTITLSTTAKESSKEFSSTFRKISASNSFYAILPSPVDVWCFGVTILYIMIGAARTEPLYRRSNDVLAISQHLTPFTTDLLCGCLALDPVER
.| |....|| || .|
---------------------------------------------------------------------------------SPEAKDFIRKCLQKDPEKR
YTAEDISR-------HPLY
.|| .. . ||
PTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | GL50803_6624.AA | CAMK | 481-516 | 30 | 4.3e-08 | 21.41 | In-house | 386-425 (425) | Show / Hide |
Range on Protein: 481-516 Range on HMM: 386-425/425 Sequence Identity: 30% (12 aa) ISQH----LTPFTTDLLCGCLALDPVERYTAEDISRHPLY ||. ... ||....| || .|.|.|.. .|| . ISDEFHHFVSQECKDLIRKMLQVDPEKRMTIEQCLNHPWM |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2 | 167-240 | 18 | 6.2e-07 | 19.81 | In-house | 148-224 (365) | Show / Hide |
Range on Protein: 167-240 Range on HMM: 148-224/365 Sequence Identity: 18% (18 aa) ISFSRRLSY---------------TIYSLHKIG-IIHKDIKVDNILFNEKHLRHNELFYAEEHPLSVDPYLIDFGISIDLSLLNT---------KIITF . ... . . . .||. . ||| ||| .|||| . .||||.| ... | ... KYIMKQILQGFKTKAEFYIACIILALEYLHSKNNIIHRDIKPENILF---------------------IKIIDFGLSKKYDDDNQNRTHKQQCKWYMF- |
|||||||||
| Kinase | GL50803_6624.AA | CMGC | 491-516 | 46 | 8.7e-07 | 17.33 | In-house | 488-513 (513) | Show / Hide |
Range on Protein: 491-516 Range on HMM: 488-513/513 Sequence Identity: 46% (12 aa) DLLCGCLALDPVERYTAEDISRHPLY |||...| .|| .| |||.. .|| DLLKKMLQYDPDKRITAEQALQHPYF |
|||||||||
| Kinase | GL50803_6624.AA | STE | 178-231 | 31 | 1.2e-05 | 16.09 | In-house | 166-198 (359) | Show / Hide |
Range on Protein: 178-231 Range on HMM: 166-198/359 Sequence Identity: 31% (17 aa) YSLHKIGIIHKDIKVDNILFNEKHLRHNELFYAEEHPLSVDPYLIDFGISIDLS | ||. .||| ||| .|||. |.|||.. |. YYLHSHHIIHRDIKPANILL---------------------VKLCDFGVCGQLT |
|||||||||
| Kinase | GL50803_6624.AA | CAMKL | 491-516 | 34 | 1.3e-05 | 13.67 | In-house | 272-297 (297) | Show / Hide |
Range on Protein: 491-516 Range on HMM: 272-297/297 Sequence Identity: 34% (9 aa) DLLCGCLALDPVERYTAEDISRHPLY ||. . | .| .|.|...| .|| . DLIRKMLQVNPEKRPTIHQIMNHPWM |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2-Unclassified | 177-245 | 26 | 1.6e-05 | 15.1 | In-house | 156-220 (352) | Show / Hide |
Range on Protein: 177-245 Range on HMM: 156-220/352 Sequence Identity: 26% (21 aa) IYSLHKIG-IIHKDIKVDNILFNEKHLRHNELFYAEEHPLSVDPYLIDFGISIDLSLLNTKIITF---------DTMLQ . .||. . ||| ||| .||||.... . .||||||. . | . |. . |.. LEYLHHKNNIIHRDIKPENILFDNNGK-------------NYYIKIIDFGISKKYQQNNNCD-TNQQQKMQIWKQQMMW |
|||||||||
| Kinase | GL50803_6624.AA | CAMKL | 180-235 | 28 | 3e-05 | 12.52 | In-house | 143-192 (297) | Show / Hide |
Range on Protein: 180-235 Range on HMM: 143-192/297 Sequence Identity: 28% (18 aa) LHKIGIIHKDIKVDNILFNEKHLRHNELFYAEEHPLSVDPYLIDFGIS---ID-----LSLLNT .|. ||.| ||| .|||. |.. . .|||| | .. .|.| CHSHGIVHRDIKPENILLDENGNN--------------NIKIIDFGFSNMYRPCIFGPGQKLKT |
|||||||||
| Kinase | GL50803_6624.AA | AGC | 473-516 | 20 | 3.6e-05 | 7.75 | In-house | 332-395 (395) | Show / Hide |
Range on Protein: 473-516 Range on HMM: 332-395/395 Sequence Identity: 20% (13 aa) RRSNDVLAIS----------QHLTPFTTDLLCGCLALDPVERYT----------AEDISRHPLY . .|. . . ....| ||. ..| || .| . ||.| .|| YFINWKVKFPFPEDPQFPEDRWFSPEAKDLIKKLLCKDPEKRLGCGGNDFGDKGAEEIKNHPWF |
|||||||||
| Kinase | GL50803_6624.AA | Pkinase | 446-516 | 17 | 6.4e-05 | 18.48 | Pfam | 190-293 (293) | Show / Hide |
Range on Protein: 446-516 Range on HMM: 190-293/293 Sequence Identity: 17% (19 aa) PSPVDVWCFGVTILYIMIGAARTEPLYRRS------NDVLAISQHLT-------------------------------PFTTDLLCGCLALDPVERYTAE ...||.| .|... . . | |... . .. | . . . |....||..|| .|.||| GPKVDMWSCGCILYEMLCGR----PPFPGHCWHDNHDQMQMICRIMGPPLHFDWPWWCSISYFFFRHWHFHWTFHNWSEECKDFIKWCLCKDPKKRPTAE DISRHPLY .| || QILQHPWF |
|||||||||
| Kinase | GL50803_6624.AA | AGC | 179-200 | 50 | 6.9e-05 | 6.99 | In-house | 168-191 (395) | Show / Hide |
Range on Protein: 179-200 Range on HMM: 168-191/395 Sequence Identity: 50% (12 aa) SLHK-IGIIHKD-IKVDNILFNEK .||. |||| | .| .|||..|. YLHSHMGIIHRDYLKPENILLDED |
|||||||||
| Kinase | GL50803_6624.AA | CAMK1 | 29-55 | 30 | 0.000163 | 8.97 | In-house | 1-30 (276) | Show / Hide |
Range on Protein: 29-55 Range on HMM: 1-30/276 Sequence Identity: 30% (9 aa) YHILRELGSGTESSVRLGQSLQS---GTQV | . |.|.|. | |.|.. .. | |. YEFGKEIGRGAFSEVYLCTHKETQTNGKQY |
|||||||||
| Kinase | GL50803_6624.AA | CMGC | 180-200 | 43 | 0.000171 | 9.66 | In-house | 198-220 (513) | Show / Hide |
Range on Protein: 180-200 Range on HMM: 198-220/513 Sequence Identity: 43% (10 aa) LHKIG--IIHKDIKVDNILFNEK .|. . ||| |.| |||.|.. CHSHWGNIIHRDLKPENILINHN |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2-Unclassified | 491-516 | 42 | 0.000263 | 10.87 | In-house | 327-352 (352) | Show / Hide |
Range on Protein: 491-516 Range on HMM: 327-352/352 Sequence Identity: 42% (11 aa) DLLCGCLALDPVERYTAEDISRHPLY |||. .| .| .|.|.|.| ||. DLLQKMLKKNPNKRITFEQILNHPWF |
|||||||||
| Kinase | GL50803_6624.AA | CAMK1 | 491-514 | 41 | 0.000387 | 7.86 | In-house | 251-274 (276) | Show / Hide |
Range on Protein: 491-514 Range on HMM: 251-274/276 Sequence Identity: 41% (10 aa) DLLCGCLALDPVERYTAEDISRHP |.... | .|| .|||.|.. .|| DFIKHMLEVDPKKRYTCEQCLNHP |
|||||||||
| Kinase | GL50803_6624.AA | MARK | 180-196 | 52 | 0.000456 | 9.38 | In-house | 120-136 (262) | Show / Hide |
Range on Protein: 180-196 Range on HMM: 120-136/262 Sequence Identity: 52% (9 aa) LHKIGIIHKDIKVDNIL .|...|.| ||| .||| CHSKNIVHRDIKPENIL |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2 | 481-516 | 26 | 0.000782 | 9.02 | In-house | 325-365 (365) | Show / Hide |
Range on Protein: 481-516 Range on HMM: 325-365/365 Sequence Identity: 26% (11 aa) ISQHLTPFTTDLLCG----CLALDPVERYT-AEDISRHPLY . ..... . ||. .| || .|.| .|.| || SWKKWSQECKDLIKKFGKRMLQKDPEKRITGWEQILNHPWF |
|||||||||
| Kinase | GL50803_6624.AA | MARK | 29-55 | 29 | 0.000835 | 8.51 | In-house | 1-27 (262) | Show / Hide |
Range on Protein: 29-55 Range on HMM: 1-27/262 Sequence Identity: 29% (8 aa) YHILRELGSGTESSVRLGQSLQSGTQV | .|...| |. . |.|.... .|..| YKMLKTIGHGSYAKVKLACHKHTGRKV |
|||||||||
| Kinase | GL50803_6624.AA | STE | 481-516 | 28 | 0.001094 | 9.04 | In-house | 322-359 (359) | Show / Hide |
Range on Protein: 481-516 Range on HMM: 322-359/359 Sequence Identity: 28% (11 aa) ISQHLTPFTTDLLCGCLALDPVERYTAEDISR--HPLY .. ...| | . || || .| ||.. . || YPHKWSPEFKDFINKCLQKDPNKRPTASQLLKSEHPFI |
|||||||||
| Kinase | GL50803_6624.AA | CAMK | 180-201 | 36 | 0.001546 | 6.47 | In-house | 195-216 (425) | Show / Hide |
Range on Protein: 180-201 Range on HMM: 195-216/425 Sequence Identity: 36% (8 aa) LHKIGIIHKDIKVDNILFNEKH .|. .|.| |.| .|||..... CHSHNIVHRDLKPENILLDDNN |
|||||||||
| Pkinase | GL50803_6624.AA | Pkinase | 29-55 | 37 | 0.004704 | 11.88 | Pfam | 1-27 (293) | Show / Hide |
Range on Protein: 29-55 Range on HMM: 1-27/293 Sequence Identity: 37% (10 aa) YHILRELGSGTESSVRLGQSLQSGTQV |||.| .|||. ..|.... .| .| YHIGRKIGSGSFGCVYKCHHKGTGKIV |
|||||||||
| Kinase | GL50803_6624.AA | MARK | 497-514 | 50 | 0.01067 | 4.84 | In-house | 243-260 (262) | Show / Hide |
Range on Protein: 497-514 Range on HMM: 243-260/262 Sequence Identity: 50% (9 aa) LALDPVERYTAEDISRHP | ..| || |.|.| .|| LTVNPEERPTIEEIMKHP |
|||||||||
| Kinase | GL50803_6624.AA | CMGC | 29-52 | 25 | 0.015286 | 3.13 | In-house | 1-24 (513) | Show / Hide |
Range on Protein: 29-52 Range on HMM: 1-24/513 Sequence Identity: 25% (6 aa) YHILRELGSGTESSVRLGQSLQSG |.|.. .|.|| . | .. ... YEIIKKIGEGTYGVVYKCRDKRTN |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2-Unclassified | 29-55 | 25 | 0.022967 | 4.04 | In-house | 1-26 (352) | Show / Hide |
Range on Protein: 29-55 Range on HMM: 1-26/352 Sequence Identity: 25% (7 aa) YHILRELGSGTESSVRLGQSLQSGTQV |.|.. .|.| ..|.. | . . |. YKIIKQIGQGGFGKVYKCQHKKQK-QY |
|||||||||
| Kinase | GL50803_6624.AA | AMPK | 180-201 | 31 | 0.029069 | 2.59 | In-house | 116-137 (254) | Show / Hide |
Range on Protein: 180-201 Range on HMM: 116-137/254 Sequence Identity: 31% (7 aa) LHKIGIIHKDIKVDNILFNEKH .|...| | | | |.|..... CHRHMIVHRDLKPENLLLDHNK |
|||||||||
| Kinase | GL50803_6624.AA | Ciliate-E2 | 29-47 | 26 | 0.043819 | 2.93 | In-house | 1-19 (365) | Show / Hide |
Range on Protein: 29-47 Range on HMM: 1-19/365 Sequence Identity: 26% (5 aa) YHILRELGSGTESSVRLGQ | ... .|.|. .||.... YKFIKKIGQGNFGSVYKCK |
|||||||||
| Kinase | GL50803_6624.AA | CAMKL | 29-55 | 32 | 0.054516 | 1.97 | In-house | 1-28 (297) | Show / Hide |
Range on Protein: 29-55 Range on HMM: 1-28/297 Sequence Identity: 32% (9 aa) YHILRELGSGTESSVRLGQS-LQSGTQV | |...|| |. . |.|.. . |..| YRIGKTLGKGSFGKVKLATHIRTTGEKV |
|||||||||
| Kinase | GL50803_6624.AA | Pkinase | 180-200 | 47 | 0.104398 | 7.12 | Pfam | 124-144 (293) | Show / Hide |
Range on Protein: 180-200 Range on HMM: 124-144/293 Sequence Identity: 47% (10 aa) LHKIGIIHKDIKVDNILFNEK .|. |||| |.| .|||.... CHSMGIIHRDLKPENILIDNN |
|||||||||
| Kinase | GL50803_6624.AA | CAMK | 34-55 | 17 | 0.123332 | 0.23 | In-house | 1-34 (425) | Show / Hide |
Range on Protein: 34-55 Range on HMM: 1-34/425 Sequence Identity: 17% (6 aa) ELGSGTESSVRLGQSLQSG------------TQV .||.|. . |.|.. ... ..| TLGRGSFGKVKLCIHKNTTGKERVHHIYTNGQKV |
|||||||||
| Kinase | GL50803_6624.AA | CAMK1 | 630-638 | 44 | 0.0174 | 2.97 | In-house | 268-276 (276) | Show / Hide |
Range on Protein: 630-638 Range on HMM: 268-276/276 Sequence Identity: 44% (4 aa) SDVLADPWI ...|..||| EQCLNHPWI |
|||||||||