Gene GL50803_7375 (G.lamblia)
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_7375.AA | Protein | None | 794 | None | Fasta, JSON |
| GL50803_7375.kin_dom | Protein Kinase Domain | None | 284 | None | Fasta, JSON |
Protein domains of GL50803_7375.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | GL50803_7375.AA | NAK | 110-144 | 25 | 0.000522 | 9.18 | In-house | 100-135 (299) | Show / Hide |
Range on Protein: 110-144 Range on HMM: 100-135/299 Sequence Identity: 25% (9 aa) SLADEISRRRS-TGSSFSESEVWEILAGIVTAIDSL ||.|.. .|.. .|. |.| |.. |. .. .. . SLWDLMNKRLMDKGTCFTEDEILQIFCDVCEGVQAM |
|||||||||
| Ank | GL50803_7375.AA | Ank | 340-370 | 36 | 4e-06 | 26.2 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 340-370 Range on HMM: 1-33/33 Sequence Identity: 36% (12 aa) HGRTALMLAAERGHLEAVKLLAS--HELQLRDE .|.|.|.||...||.| ||.| . .. ..| DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
| Ank | GL50803_7375.AA | Ank | 371-403 | 33 | 6e-06 | 25.82 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 371-403 Range on HMM: 1-33/33 Sequence Identity: 33% (11 aa) KGMTALMYAAMAGRANVVSYLIVAGSQSGAQET |.|.|..|.. |...||..|. .| || DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
| Ank | GL50803_7375.AA | Ank | 409-429 | 28 | 0.166106 | 9.69 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 409-429 Range on HMM: 1-21/33 Sequence Identity: 28% (6 aa) DNHCALMYAISHNRAECVRIL | .|..|......|.|. | DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_7375.AA | Ank | 442-453 | 33 | 29.407432 | 1.58 | Pfam | 1-12 (33) | Show / Hide |
Range on Protein: 442-453 Range on HMM: 1-12/33 Sequence Identity: 33% (4 aa) GGETVLMWAVHK |.| |..|... DGFTPLHLACRC |
|||||||||
| Ank | GL50803_7375.AA | Ank | 476-497 | 40 | 0.312518 | 8.7 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 476-497 Range on HMM: 1-22/33 Sequence Identity: 40% (9 aa) SGKTALMLAAITGFTTAINTLL | |.|.||.. | | . || DGFTPLHLACRCGHTEVVKMLL |
|||||||||
| Ank | GL50803_7375.AA | Ank | 506-526 | 28 | 0.000896 | 17.87 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 506-526 Range on HMM: 1-21/33 Sequence Identity: 28% (6 aa) HGRTALMYAVLESNADAVELL .|.|.|..|.. ... |..| DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_7375.AA | Ank | 568-590 | 34 | 0.001257 | 17.34 | Pfam | 1-23 (33) | Show / Hide |
Range on Protein: 568-590 Range on HMM: 1-23/33 Sequence Identity: 34% (8 aa) DGLTPLMVAAKTANRRVFDLLID || |||..|.. . .| .|.. DGFTPLHLACRCGHTEVVKMLLQ |
|||||||||
| Ank | GL50803_7375.AA | Ank | 680-707 | 16 | 0.712093 | 7.41 | Pfam | 4-33 (33) | Show / Hide |
Range on Protein: 680-707 Range on HMM: 4-33/33 Sequence Identity: 16% (5 aa) TALMMAINNRNIDCASLLVE--REAGIQTK |.|..|. . .......|.. . .|.. TPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||
| Ank | GL50803_7375.AA | Ank | 708-728 | 33 | 1.843478 | 5.92 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 708-728 Range on HMM: 1-21/33 Sequence Identity: 33% (7 aa) EGLTALMRAAEMDYIMGVKLL .| |.|. |...... ||.| DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_7375.AA | Ank | 739-768 | 18 | 6e-05 | 22.11 | Pfam | 1-33 (33) | Show / Hide |
Range on Protein: 739-768 Range on HMM: 1-33/33 Sequence Identity: 18% (6 aa) NGWCALMWAASKNNISCVRLLLS---EQDLRNN .|. .|..|........|..||. . ..... DGFTPLHLACRCGHTEVVKMLLQHGADVNAQDD |
|||||||||