Gene C01H6.9 (Nematode worm)
C01H6.9
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| C01H6.9.kin_dom | Protein Kinase Domain | Sugen global kinase HMM prediction | 281 | Kinase domain by global Sugen HMM | Fasta, JSON |
| C01H6.9.AA | Protein | Genbank | 920 | None | Fasta, JSON |
Protein domains of C01H6.9.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | C01H6.9.AA | Haspin | 590-853 | 41 | 3.1e-134 | 452.27 | In-house | 1-264 (264) | Show / Hide |
Range on Protein: 590-853 Range on HMM: 1-264/264 Sequence Identity: 41% (110 aa) RVKKLGEGAYGEVFSTIWDGKPVAIKIVPFEKDGCNRQYFGEYHSEEMQTSDVVLPEVIVMKELSALRDEDAWNSTPNFIEMISAEVVMGKYPKGLLSAW ..||.|||.||||||..|.||.|..|| |.. . |. |.|||..|..|| |..|.|.|.||....|.........|||..|.....|.||..|.|...| NCKKIGEGCYGEVFSVTWNGKEVVMKIIPIHWSCCK--YYGEYCGEHQQTNDEALNEIIIMKKMGKLSHRNMCPNFPNFCGMCVVTQVPGKCCKKLNKMW DSYDKLKESENTRPDVYSSIDQNFILFVSANGGIALEDF--VLESENELFSIIHQLVLSMNAAEAALEFEHRDLHLGNVLID-RNGVKELYYTVHGQKVP | |.....|||.|||... .|..|......||..|..| ....|. .||..|||.|| .|.....|.|.|||.|||||. ....|.|.||..|.... DHYCYTHHSENDRPDFFK-KNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTMDGKTIK LSTHGIKVNIIDFTLSRISKGATTVYWDLENDPAIFEGQDDPQFEVYREMRKNCKSNWKKFSRRTNL . .||..|.||||..||..|. ...|||..|| ..||...|.||.|||.|||||...|........ IKSHGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMRKNCQHFWFVHHAKNWK |
|||||||||
| Kinase | C01H6.9.AA | DUF3635 | 819-863 | 32 | 2.9e-09 | 33.52 | Pfam | 1-56 (121) | Show / Hide |
Range on Protein: 819-863 Range on HMM: 1-56/121 Sequence Identity: 32% (18 aa) PAIFEGQD---------DPQFEVYREMRKNCKS--NWKKFSRRTNLMWIVYIANRL . | |.. | ||..|| ||| | .| .|. .||..| | | HDFFQGKGKSKINEYQYDYQFDIYRMMRKMLKNPICWSQFHPMTNVLWLHYLIHKL |
|||||||||
| Kinase | C01H6.9.AA | MOS | 589-617 | 34 | 6.2e-09 | 25.53 | In-house | 2-30 (299) | Show / Hide |
Range on Protein: 589-617 Range on HMM: 2-30/299 Sequence Identity: 34% (10 aa) RRVKKLGEGAYGEVFSTIWDGKPVAIKIV . .| |..|.|. .. | |||.|.| CLCQMIGRGGFGSVWKAQYCGRPVAVKQV |
|||||||||
| Kinase | C01H6.9.AA | Src | 588-615 | 41 | 4.1e-08 | 23.61 | In-house | 1-29 (255) | Show / Hide |
Range on Protein: 588-615 Range on HMM: 1-29/255 Sequence Identity: 41% (12 aa) GRRVKKLGEGAYGEVFSTIWDG-KPVAIK ....|||.| .|||. .|.| .||.| IKLCRKLGQGQFGEVWMGYWNGNTKVAVK |
|||||||||
| Kinase | C01H6.9.AA | Src-Unclassified | 589-615 | 42 | 5.3e-08 | 23.45 | In-house | 2-29 (284) | Show / Hide |
Range on Protein: 589-615 Range on HMM: 2-29/284 Sequence Identity: 42% (12 aa) RRVKKLGEGAYGEVFSTIWDG-KPVAIK ....||| | |||. .|.| ||.| HLLRKLGRGQFGEVWYGKWRGKVDVAVK |
|||||||||
| Kinase | C01H6.9.AA | TKL | 594-622 | 30 | 9e-08 | 24.08 | In-house | 1-39 (364) | Show / Hide |
Range on Protein: 594-622 Range on HMM: 1-39/364 Sequence Identity: 30% (12 aa) LGEGAYGEVFSTIWDG----------KPVAIKIVPFEKD .|.|..|||. .| | |.||.|. . . | IGSGGFGEVYKGKWRGWGGKCPSDTGKDVAVKKFKSHND |
|||||||||
| Kinase | C01H6.9.AA | SFK-Abl | 592-615 | 58 | 1.8e-07 | 20.19 | In-house | 5-28 (251) | Show / Hide |
Range on Protein: 592-615 Range on HMM: 5-28/251 Sequence Identity: 58% (14 aa) KKLGEGAYGEVFSTIWDGKPVAIK |||| ||||. || . |||| HRLGEGQYGEVYKGIWNNHRVAIK |
|||||||||
| Kinase | C01H6.9.AA | Dicty4 | 589-623 | 31 | 2.7e-07 | 20.56 | In-house | 2-36 (277) | Show / Hide |
Range on Protein: 589-623 Range on HMM: 2-36/277 Sequence Identity: 31% (11 aa) RRVKKLGEGAYGEVFSTIWDGKPVAIKIVPFEKDG . ...|.|..|||. .| || ||.|. . ... NIEQRIGKGSFGEVYKGTWRGKEVAVKKLNNHNQN |
|||||||||
| Kinase | C01H6.9.AA | TKL-Unique | 590-616 | 51 | 2.9e-07 | 21.84 | In-house | 1-27 (290) | Show / Hide |
Range on Protein: 590-616 Range on HMM: 1-27/290 Sequence Identity: 51% (14 aa) RVKKLGEGAYGEVFSTIWDGKPVAIKI ..|.|||.||.|. ..| |.|||||. FWNKIGEGGYGQVYKGKWRGYPVAIKQ |
|||||||||
| Kinase | C01H6.9.AA | MST | 591-622 | 52 | 3.1e-07 | 18.95 | In-house | 4-37 (254) | Show / Hide |
Range on Protein: 591-622 Range on HMM: 4-37/254 Sequence Identity: 52% (18 aa) VKKLGEGAYGEVFSTIW--DGKPVAIKIVPFEKD | |||.|.|| |. | .|| ||||.|| . | VEKLGQGSYGSVYKAIHKQTGKIVAIKMVPVNED |
|||||||||
| Kinase | C01H6.9.AA | CMGC | 588-626 | 20 | 4.3e-07 | 18.36 | In-house | 1-70 (513) | Show / Hide |
Range on Protein: 588-626 Range on HMM: 1-70/513 Sequence Identity: 20% (14 aa) GRRVKKLGEGAYGEVFSTIW----------------DGKPVAIKIVP---FEKDGC------------NR .||.|||.||.|.. . ... ||||.. .| ... .| YEIIKKIGEGTYGVVYKCRDKRTNQKKDNGQAHHHETNEIVAIKKIKNPFYEEQAKSTIEKDGFPIRALR |
|||||||||
| Pkinase | C01H6.9.AA | Pkinase | 588-618 | 30 | 1e-06 | 24.85 | Pfam | 1-33 (293) | Show / Hide |
Range on Protein: 588-618 Range on HMM: 1-33/293 Sequence Identity: 30% (10 aa) GRRVKKLGEGAYGEVFSTIWDGKP--VAIKIVP ....|.|.|..|.|. .. | . ||.||.. YHIGRKIGSGSFGCVYKCHHKGTGKIVAVKIIK |
|||||||||
| Kinase | C01H6.9.AA | S_TKc | 588-905 | 11 | 5e-05 | -103.14 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 588-905
Range on HMM: 1-231/231
Sequence Identity: 11% (41 aa)
GRRVKKLGEGAYGEVFSTIW--DGKPVAIKIVPFEKDGCNRQYFGEYHSEEMQTSDVVLPEVIVMKELSALRDEDAWNSTPNFIEMISAEVVMGKYPKGL
. ..|.|.||.|.|. .. .|. |||||.. ...|.. |. || . .. . .
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK----------------------------EHIRREIQILKK-----HHPNIVKLYDVFQD--------
LSAWDSYDKLKESENTRPDVYSSIDQNFILFVSANGGI---ALEDFVLE----------SENELFSIIHQLVLSMNAAEAALEFEHRDLHLGNVLIDRNG
... .| . | |. . .| . ....|... .. . |||| |.|.|.
--------------------------DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFPFPE-HARFYMYQICCALEYCHSH-GIIHRDLKPENILLDE--
VKELYYTVHGQKVPLSTHGIKVNIIDFTLSRISKGATTV-----------YWDL-END--------------PAIFEGQDDPQFEVYREMRKNCKSNWKK
. |.|| |.|. | . .. . | |. ...... ..
--------------------HIKICDFGLARQL--TTFCGTPWYMAPEVLGYGKCKCDWWSCGCILYEMLCGYPPFP----QMQMMFKKIG---------
FSRRTNLMWIVYIANRLIDTKICPKGLLTEKRRMELKVLFDRFAEF-----GSCGESLT------NEEFF
|.| . .. .. .. | |. . ..|
--------------------------------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | C01H6.9.AA | Pkinase_Tyr | 589-617 | 42 | 0.000165 | 15.89 | Pfam | 2-36 (270) | Show / Hide |
Range on Protein: 589-617 Range on HMM: 2-36/270 Sequence Identity: 42% (15 aa) RRVKKLGEGAYGEVFSTIWD------GKPVAIKIV . |||||||.|||. .|. . |||.|.. TFGKKLGEGAFGEVYKGTWKGDPDNTKIPVAVKML |
|||||||||
| Kinase | C01H6.9.AA | TKL | 758-774 | 28 | 0.322768 | 0.15 | In-house | 163-194 (364) | Show / Hide |
Range on Protein: 758-774 Range on HMM: 163-194/364 Sequence Identity: 28% (9 aa) HRDLHLGNVLIDRNG---------------VK |||| |.|.|.|. .| HRDLKSKNILVDENWTNVSNYMYNPNADWCCK |
|||||||||