Gene Y40A1A.1 (Nematode worm)

Y40A1A.1

Species: Nematode worm
Alias: CE24251, aSWK223, Y40A1A.1, Y40A1A.17
External Links: Wormbase Link ,
Annotation: WormBase Genetic Map location: X:-15.3, WormBase Physical Map location: X: 2004749-2006434

Classification

Group: Other
Family: Haspin

Sequence

Name Sequence Type Origin Length Description Download
Y40A1A.1.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 241 Kinase domain by global Sugen HMM Fasta, JSON
Y40A1A.1.AA Protein Genbank 319 None Fasta, JSON

Protein domain

Protein domains of Y40A1A.1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase Y40A1A.1.AA Haspin 73-298 35 5.5e-105 355.08 In-house 1-264 (264) Show / Hide 
Range on Protein: 73-298
Range on HMM: 1-264/264
Sequence Identity: 35% (95 aa)

NVAKVGEGCFAEAFSTTFKNVSVVVKVLPLRDGPI---GKDCDEYVQRTEAVLAELIVLKLLSALSTKNRPNVTENFVKLVMTKVVVGKYPTSLLKAWDK
|..|.||||..|.||.|... .||.|..|...  .   |..|.|..|.....|.|.|..| ...||..|. ....||..... ..|.||....|.|.||.
NCKKIGEGCYGEVFSVTWNGKEVVMKIIPIHWSCCKYYGEYCGEHQQTNDEALNEIIIMKKMGKLSHRNMCPNFPNFCGMCVVTQVPGKCCKKLNKMWDH

FRVEEQSGNIRPSKFKKNQLYLLLIMSNGGTPLEKF--EMDNIGQFCSIIQQLLFSLAIAEKEMQFEHRDLHLGNVLIK-K-------------------
......|.|.||..||||||....||..||.||..|  ..... |..||..||..|..||..||||.|.|||.|||||| |                   
YCYTHHSENDRPDFFKKNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTMDGKTIKIKS

-------------QVWESTQIIYEDMEKDGAMFEGFGDSQFDVYREMRSNCKRNWQLFSSKSNI
             .... .. ||.|...| .|||.|.|.||||||.||.||...|.....|...
HGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMRKNCQHFWFVHHAKNWK
Kinase Y40A1A.1.AA DUF3635 264-300 33 2e-06 23.58 Pfam 1-48 (121) Show / Hide 
Range on Protein: 264-300
Range on HMM: 1-48/121
Sequence Identity: 33% (16 aa)

GAMFEGFG---------DSQFDVYREMRSNCKR--NWQLFSSKSNIMW
  .| | |         | |||.|| ||.  |   .|  |. ..|..|
HDFFQGKGKSKINEYQYDYQFDIYRMMRKMLKNPICWSQFHPMTNVLW