Gene Y40A1A.1 (Nematode worm)
Y40A1A.1
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| Y40A1A.1.kin_dom | Protein Kinase Domain | Sugen global kinase HMM prediction | 241 | Kinase domain by global Sugen HMM | Fasta, JSON |
| Y40A1A.1.AA | Protein | Genbank | 319 | None | Fasta, JSON |
Protein domains of Y40A1A.1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | Y40A1A.1.AA | Haspin | 73-298 | 35 | 5.5e-105 | 355.08 | In-house | 1-264 (264) | Show / Hide |
Range on Protein: 73-298
Range on HMM: 1-264/264
Sequence Identity: 35% (95 aa)
NVAKVGEGCFAEAFSTTFKNVSVVVKVLPLRDGPI---GKDCDEYVQRTEAVLAELIVLKLLSALSTKNRPNVTENFVKLVMTKVVVGKYPTSLLKAWDK
|..|.||||..|.||.|... .||.|..|... . |..|.|..|.....|.|.|..| ...||..|. ....||..... ..|.||....|.|.||.
NCKKIGEGCYGEVFSVTWNGKEVVMKIIPIHWSCCKYYGEYCGEHQQTNDEALNEIIIMKKMGKLSHRNMCPNFPNFCGMCVVTQVPGKCCKKLNKMWDH
FRVEEQSGNIRPSKFKKNQLYLLLIMSNGGTPLEKF--EMDNIGQFCSIIQQLLFSLAIAEKEMQFEHRDLHLGNVLIK-K-------------------
......|.|.||..||||||....||..||.||..| ..... |..||..||..|..||..||||.|.|||.|||||| |
YCYTHHSENDRPDFFKKNQLHIHWIMEYGGRPLDNFRWKFNTCNQCISIMCQLVMSMYIAKDEMQFWHNDLHWGNVLIKRKTKKKWLHYTMDGKTIKIKS
-------------QVWESTQIIYEDMEKDGAMFEGFGDSQFDVYREMRSNCKRNWQLFSSKSNI
.... .. ||.|...| .|||.|.|.||||||.||.||...|.....|...
HGVMVTIIDFCKSRCGKDNKKIYWDWKNDETMFEQFWDYQFDVYRDMRKNCQHFWFVHHAKNWK
|
|||||||||
| Kinase | Y40A1A.1.AA | DUF3635 | 264-300 | 33 | 2e-06 | 23.58 | Pfam | 1-48 (121) | Show / Hide |
Range on Protein: 264-300 Range on HMM: 1-48/121 Sequence Identity: 33% (16 aa) GAMFEGFG---------DSQFDVYREMRSNCKR--NWQLFSSKSNIMW .| | | | |||.|| ||. | .| |. ..|..| HDFFQGKGKSKINEYQYDYQFDIYRMMRKMLKNPICWSQFHPMTNVLW |
|||||||||