MEK1

Species: Bakers Yeast
Alias: MEK1
External Links: Saccharomyces Genome Database Link ,
Annotation:

Classification

Group: CAMK
Family: CAMK-Unique

Sequence

Name Sequence Type Origin Length Description Download
MEK1.kin_dom Protein Kinase Domain Sugen global kinase HMM prediction 284 Kinase domain by global Sugen HMM Fasta, JSON
MEK1.AA Protein Refseq_NP 497 `Disp. for chr. pairing & chr. condensation seen by in situ hybrid. Required for full double strand breaks, normal length synaptonemal complexes, meiotic recomb. & spore viability. mek1 is rescued by spo13 & in early recomb. function; Mek1p [Saccharomyces cerevisiae]` Fasta, JSON

Protein domain

Protein domains of MEK1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
FHA MEK1.AA FHA 47-119 30 4.3e-21 81.18 Pfam 1-73 (73) Show / Hide
Range on Protein: 47-119
Range on HMM: 1-73/73
Sequence Identity: 30% (24 aa)

VKVGRNDKECQLVLT-NPS-ISSVHCVFWCVFFDEDSIPMFYVKD--CSLNGTYL--NGLLLKRDKTYLLKHCDVIELS
...||. ..| .||  .|| .| .||.. . ..|..    .|..|  || |||..  ||  ....... |.| |.| . 
WTIGRD-PDCDIVLDNDPSFVSRHHCEI-R-RYDNG---RWYIRDLGCSTNGTFVTGNGQRIQPGEPHRLHHGDRIRFG

FHA MEK1.AA FHA 46-102 33 1.6e-14 55.49 SMART 1-49 (49) Show / Hide
Range on Protein: 46-102
Range on HMM: 1-49/49
Sequence Identity: 33% (20 aa)

LVKVGRNDKECQLVLTNPSISSVHCVFWCVFFDEDSIPMFYVKDCS---LNGTYLNGLLL
 ...||.   |...|..|||| .||...    |.|     |..|..    ||||.||  .
TWTIGRHS--CDIQLPHPSISRHHCQIR----DGD-----YIIDLGEHSTNGTYVNGRRV

Kinase MEK1.AA CAMK-Unique 162-444 30 7e-155 514.88 In-house 1-363 (363) Show / Hide
Range on Protein: 162-444
Range on HMM: 1-363/363
Sequence Identity: 30% (112 aa)

EITNRIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKIIKLKP----------------NKFDKEARILLRLDHPNIIKVYHT----FCDRNN------
....||.|.|.||||.............|...........|.|.                .|...|..|....|||||||.|..    ||||..      
YKMHRIIGHGNFGHVYECMDRETGKKWACKMVKKQTHGNKKQKQQRNFDLRYKITEKRRDMKLKREHQIWKMVDHPNIIKLYDWNNPIFCDRKYPLCDLI

--------HLYIFQDLIPGGDLFSYLAKG-----------------DCLTSMSE--TESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTPEP-----
        ..||......|||||....|.                 .| ...||  .....|....|.|..|.|.||||||||||.||..|....     
IKTPRALPYMYIVMEYCQGGDLFDWIQKWDEFYFNFIIKFDFNILKRCQGHFSERCWDTCFIMQCLLSAVAYMHSQDIVHRDLKLENIMVCYSFKDNNHH

--------CTRIVLADFGIAKDLNSNKER--MHTVVGTPEYCAPEVGFRANRKAYQSFSRAATLEQRGYDSKC----DLWSLGVITHIMLTGISPFYGDG
        ...|.|.|||.....|.||..  |.|..|||.|.|||..|..|   ||...|........||..|    |.||||||...||.|..||....
RDFPYDWSNWHIKLCDFGLCCHYNHNKMCHMMQTMCGTPCYMAPEIVFCKN---YQEMTRDEVINMQCYDQQCSPASDIWSLGVIMYYMLCGCPPFDCEC

SER-------SIIQNAKIGKL-NFKLKQWDI---VSDNAKSFVKDLLQTDVVKRLNSKQGLKHIWI
..|       .|......|.. ||. |.|..   .|..||.|||.....|...|...|..|.|.||
EDRDYENHDKEIFECICKGDYCNFDWKMWHGPDYISQEAKDFVKCCMTVDPDHRWSAKELLEHQWI

Kinase MEK1.AA CAMK 167-444 23 1.9e-94 304.76 In-house 1-425 (425) Show / Hide
Range on Protein: 167-444
Range on HMM: 1-425/425
Sequence Identity: 23% (105 aa)

IVGNGTFGHVLITHNSKERDEDVCYHPEN---------------YAVKIIKLK--------------------------------PNKFDKEARILLR--
. | |.|| |             |.| ..               .|.|||. |                                  .. .| .|. .  
TLGRGSFGKVK-----------LCIHKNTTGKERVHHIYTNGQKVAIKIIDKKKLKDKQNQDYSNCYKIDKSKCKHRYCWRRPKDRKNVRREIEIMKKLQ

-----LDHPNIIKVYHTFCDRNN------------------HLYIFQ---DLIPGG----DLFSYLAKGDCL------------TSMSETESLLIVFQIL
     |||||||| |... |...                  |.|..    ....||    |||.|. .  |               ..| |   .. ||.
GIGNKLDHPNIIKLYEVYEDPHYFKNTNDYETSKQVFTKDKHMYMVMEIMEYCSGGELFDDLFDYIVEHGCYGEEFDQFDIVERGRFTEREARRYFRQIC

QALNYLHDQDIVHRDLKLDNILLCTPEPCT--------------RIVLADFGIAKDLNSNK-----------------------ERMHTVVGTPEYCA-P
.|..|.|...|||||||..||||.. .. .               | ..||| |. .....                       . |.|..|||||.| |
SAVHYCHSHNIVHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFANKFDPGENNFMCSDYKGGEMHNQWTTPTEGQKMKTFCGTPEYMAAP

EVGFRANRKAYQSFSRAATLEQRGYDSKCDLWSLGVITHIMLTGISPFYGDG------------SERSIIQNAKIGKLNFKLKQ------------WDIV
||  .  ....|  . |   |...|. ||| ||.|||. |||.| .|||||             ... . .. . || .|  ..            || .
EVLNGKGHCNMQ--N-ATDEEKPYYGPKCDMWSCGVILYIMLCGYPPFYGDCDNEICEDEWIGMNDYELFEKIMKGKYDFPPPYFSPISCNYGPEWWDDI

SDN--------AKSFVKDLLQTDVVKRLNSKQGLKHIWI
||.        .|.... .||.|  ||.. .| |.| |.
SDEFHHFVSQECKDLIRKMLQVDPEKRMTIEQCLNHPWM

Kinase MEK1.AA Pkinase 162-444 30 3.9e-94 323.83 Pfam 1-293 (293) Show / Hide
Range on Protein: 162-444
Range on HMM: 1-293/293
Sequence Identity: 30% (98 aa)

EITNRIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKIIKLKPNKFDK--------EARILLRLDHPNIIKVYHTFCDRNNHLYIFQDLIPGG----DL
  . |..| |.|| | . |. ....         .||||||.. .| .|        |..|..||.||||.. |..| | ..|.|. ... .||    ||
YHIGRKIGSGSFGCVYKCHHKGTGK--------IVAVKIIKKRHEKSWKDQTHRRLSEIQIMKRLNHPNIVRLYDWFED-KDHIYMVMEYCEGGLYVMDL

FSYLA--KGDCLTSMSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLC-TPEPCTRIVLADFGIAKDL-NSNKERMHTVVGTPEYCAPEVGFRANR
|.|.   .. |.. .|| |   .. |||..|.|.|.. |.|||||..|||.  ........ ..|||.|| . . |.. |.|..|||.|.||||      
FDYISTWRHGCFY-FSEWECKFYMYQILRGLEYCHSMGIIHRDLKPENILIDNNGHIDACVKICDFGLAKQFDY-NNS-MTTFCGTPWYMAPEV------

KAYQSFSRAATLE-QRGYDSKCDLWSLGVITHIMLTGISPFYGD-----GSERSIIQNAKIGKLNFKLKQWDIVS-----------------DNAKSFVK
           .  ...|..|.| ||.|.| ..||.|  ||.|.      ... .|.. . ..| |   .|. .|                 ...|.|.|
-----------IRGGQYYGPKVDMWSCGCILYEMLCGRPPFPGHCWHDNHDQMQMICRIMGPPLHFDWPWWCSISYFFFRHWHFHWTFHNWSEECKDFIK

DLLQTDVVKRLNSKQGLKHIWI
..|. |  ||.. .| |.| |.
WCLCKDPKKRPTAEQILQHPWF

Kinase MEK1.AA S_TKc 162-444 30 5.5e-84 286.23 SMART 1-231 (231) Show / Hide
Range on Protein: 162-444
Range on HMM: 1-231/231
Sequence Identity: 30% (91 aa)

EITNRIVGNGTFGHVLITHNSKERDEDVCYHPENYAVKIIKLKPNKFDKEARILLRLDHPNIIKVYHTFCDRNNHLYIFQDLIPG--GDLFSYLAKGDCL
    |..| |.|| |   .. |          . .|.||||   ... .| .|| . .||||.| | .| |  .|||.. ....|  ||||.|. |  . 
YEILRKIGKGAFGKVYKCRHKK--------TGRIVAIKIIK---EHIRREIQILKK-HHPNIVKLYDVFQD--DHLYMVMEYCDGDLGDLFDYIKKRGRH

TS---MSETESLLIVFQILQALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVGFRANRKAYQSFSRAAT
     ..| .   .. ||..||.|.|.. |.||||| .||||..     .| ..|||.|. |       .|..|||.|.||||                 
GLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE-----HIKICDFGLARQL-------TTFCGTPWYMAPEVL----------------

LEQRGYDS-KCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLLQTDVVKRLNSKQGLK-------HIWI
    ||.  ||| ||.|.|  .||.|  ||.    .  .... .              |. ||.|.. .|| |  ||.   . |.       | |.
----GYGKCKCDWWSCGCILYEMLCGYPPFP---QMQMMFKKIG--------------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF

Kinase