TAO1

Species: Human
Alias: KIAA1361, FLJ14314, TAOK1, MARKK, PSK2, MAP3K16, TAO1
External Links: iHOP , Entrez Gene , Refseq cDNA , Refseq Protein , Phosphosite , GeneCards
Annotation: Consensus chromosomal location: 17q11.1-q11.2,

Classification

Group: STE
Family: STE20
Subfamily: TAO

Sequence

Name Sequence Type Origin Length Description Download
TAO1.NA RNA Sugen Kinome 4662 None Fasta, JSON
TAO1.AA Protein Sugen Kinome 1001 None Fasta, JSON
TAO1.kin_dom Protein Kinase Domain Sugen Kinome 254 None Fasta, JSON

Protein domain

Protein domains of TAO1.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase TAO1.AA TAO 28-281 87 1.1e-203 671.68 In-house 1-254 (254) Show / Hide
Range on Protein: 28-281
Range on HMM: 1-254/254
Sequence Identity: 87% (222 aa)

FTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVE
|.||||||||||||||||||..|.|||||||||||||||.||||||||||.|||..||||.||||||||||||.|||||||||||||.|.|||||.||||
FQDLREIGHGSFGAVYFARDKHTEEVVAIKKMSYSGKQSHEKWQDIIKEVRFLQQVKHPNCIEYKGCYLREHTCWLVMEYCLGSASDILDVHKKPMQEVE

IAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFN
||||.|||||||.|||||.|||||||||||||||.|||||||||||||..||||||||||||||||||||||||||||||||||||||||||||||||||
IAAICHGALQGLRYLHSHKMIHRDIKAGNILLTEHGQVKLADFGSASMVCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFN

MNAMSALYHIAQNESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFV
|||||||||||||.|||||.|||||.|..|||.||||.||.||..||.|.| ||
MNAMSALYHIAQNDSPTLQQNEWSDCFHQFVDKCLQKMPQERPSAEECLRHEFV

Kinase TAO1.AA STE20 28-281 47 5.2e-150 504.65 In-house 1-288 (288) Show / Hide
Range on Protein: 28-281
Range on HMM: 1-288/288
Sequence Identity: 47% (137 aa)

FTDLREIGHGSFGAVYFARDVRTNEV----VAIKKMSYSGK---QSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTA----WLVMEYCLG-SASDL
...|..||.||.|.||.|....|.|.    ||||||... .   |  ..|.||.||. .... |||| ..| |.||...|.    |.||||| | |..|.
YELLEKIGQGSYGKVYKAYHKPTGEYCNQRVAIKKMNLEKCDNEQ--DEWEDIQKEISIMKQCKHPNIVKYYGSYLKDDTCDDELWIVMEYCGGGSLTDI

LE---VHKK-----PLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFG-SASMAS--------PANSFVGTPYWMAPEVILAMD
..   ...|     |..|..||.|....||||.||||. .|||||||.|||||| |.||||||| .|.. .        . |.|||||||||||||. |.
MKHCMKCGKNHKGHPMNEEQIAYICREVLQGLDYLHSNHIIHRDIKADNILLTEDGEVKLADFGVCAQLTKHGRDTMQFKRNTFVGTPYWMAPEVIQCME

--EGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIA--QNESPTLQ---SNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFV
  ...|| |.|.||||||.||.||..||.|.|..|.|...|.  ||..|||.   .. ||. |..|||.|||| |..|||...|||| |.
GPDKGYDYKCDIWSLGITAIEMAEGEPPYFDMHPMRAMFMIPKNQNPPPTLKDDKPHKWSPEFHDFVDKCLQKDPEKRPTASQLLKHPFI

Kinase TAO1.AA STE 28-281 32 1.5e-123 416.79 In-house 1-359 (359) Show / Hide
Range on Protein: 28-281
Range on HMM: 1-359/359
Sequence Identity: 32% (120 aa)

FTDLREIGHGSFGAVYFARDV------RTNEV---------VAIKKMSYSGKQS--------------TEKWQDIIKEVKFLQRIK--HPNSIEYKGCYL
......||.|.|| || |...      .|.||         .|||.|... ...              .|..|.|.||.|.... .  ||| ..| |||.
WEGIEKIGKGAFGTVYKAMNHKNCNIHKTGEVENNGETGEIMAIKQMNLENCNNKDENQENQELENKNHEEMQQILKEIKIMKKCNHMHPNIVKYYGCYF

RE-------HTAWLVMEYCL-GSASDLLE---VHKKPLQ----------EVEIAAITHGALQG-LAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSAS
.|       .. |..|||.  ||..|...    ..|||.          | .||.|..  |.| |.|||||  ||||||..||||     |||.||| ..
KEGHNHKNDDELWICMEYMDGGSLDDIIKHKYGCGKPLNHNRQHQHRFPESQIAYICRQILKGLLYYLHSHHIIHRDIKPANILL-----VKLCDFGVCG

MASP--------------------ANSFVGTPYWMAPEVILAMDEG---QYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN-----------
  ..                     |.||||| |||||||. ...|   .|| |.|.||||.|.||.|. |||...|. |.|...|..|           
QLTDSMANIQSNNIIDCIETMQQKRNTFVGTP-WMAPEVIQQNGQGRDKGYDTKCDIWSLGCTIIEMATGKPPWHDMHPMRAMFMIPFNYHMQQQFEQLC

----ESPTLQSN------------------EWSDYFRNFVDSCLQKIPQDRPTSEELLK--HIFV
    ..|.|...                  .||. |..|.. |||| |..|||...|||  | |.
IVNGPPPPLPDHLSQNEMISYGGSGTTYPHKWSPEFKDFINKCLQKDPNKRPTASQLLKSEHPFI

Kinase TAO1.AA MST 28-281 43 5.2e-106