Gene DDB0231335 (Slime mold)
DDB0231335
Group:
Other
Family:
Other-Unique
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| DDB0231335.AA | Protein | None | 921 | None | Fasta, JSON |
| DDB0231335.kin_dom | Protein Kinase Domain | None | 23 | None | Fasta, JSON |
Protein domains of DDB0231335.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | DDB0231335.AA | Kin1 | 580-613 | 52 | 9.4e-07 | 21.28 | In-house | 146-179 (279) | Show / Hide |
Range on Protein: 580-613 Range on HMM: 146-179/279 Sequence Identity: 52% (18 aa) IQHRDLHAANILIKEDGSLSIIDYGYSNIGDDRK | |||| ||.| . . . |||.| ||| | || IVHRDLKIENIMISDSSEIKIIDFGLSNIYDYRK |
|||||||||
| Kinase | DDB0231335.AA | FRAY | 582-606 | 60 | 1e-06 | 16.09 | In-house | 130-154 (277) | Show / Hide |
Range on Protein: 582-606 Range on HMM: 130-154/277 Sequence Identity: 60% (15 aa) HRDLHAANILIKEDGSLSIIDYGYS |||. | |||| |||. | |.| | HRDIKAGNILIGEDGTIQIADFGVS |
|||||||||
| Kinase | DDB0231335.AA | NuaK | 579-613 | 42 | 1.9e-05 | 9.69 | In-house | 119-153 (252) | Show / Hide |
Range on Protein: 579-613 Range on HMM: 119-153/252 Sequence Identity: 42% (15 aa) EIQHRDLHAANILIKEDGSLSIIDYGYSNIGDDRK .| |||| ||| ... | |.| ||. .| | RICHRDLKLENILLDQNCNAKIADFGLSNYYHDQK |
|||||||||
| Kinase | DDB0231335.AA | CCRK | 579-604 | 57 | 6.4e-05 | 12.6 | In-house | 119-144 (285) | Show / Hide |
Range on Protein: 579-604 Range on HMM: 119-144/285 Sequence Identity: 57% (15 aa) EIQHRDLHAANILIKEDGSLSIIDYG .| |||| ||.|| | | | | |.| NIMHRDLKPANLLISESGHLKIADFG |
|||||||||
| Kinase | DDB0231335.AA | Ciliate-E8 | 580-606 | 41 | 9.7e-05 | 10.76 | In-house | 110-138 (138) | Show / Hide |
Range on Protein: 580-606 Range on HMM: 110-138/138 Sequence Identity: 41% (12 aa) IQHRDLHAANILIKE--DGSLSIIDYGYS | | |. |||.. | |||.|.| IIHCDFKLNNILVQRNDDTKIKIIDFGFS |
|||||||||
| Kinase | DDB0231335.AA | RSK | 582-606 | 37 | 0.000113 | 12.88 | In-house | 124-152 (271) | Show / Hide |
Range on Protein: 582-606 Range on HMM: 124-152/271 Sequence Identity: 37% (11 aa) HRDLHAANILIKED----GSLSIIDYGYS |||| ..|||. .. |.. | |.| . HRDLKPENILYDDESGNPGHIKICDFGFA |
|||||||||
| Kinase | DDB0231335.AA | HH498 | 582-606 | 56 | 0.000135 | 10.05 | In-house | 147-171 (284) | Show / Hide |
Range on Protein: 582-606 Range on HMM: 147-171/284 Sequence Identity: 56% (14 aa) HRDLHAANILIKEDGSLSIIDYGYS |||| |||| ||| . |.| | HRDLNSHNILIHEDGHAVVADFGES |
|||||||||
| Kinase | DDB0231335.AA | JNK | 580-607 | 42 | 0.000172 | 12.73 | In-house | 127-154 (309) | Show / Hide |
Range on Protein: 580-607 Range on HMM: 127-154/309 Sequence Identity: 42% (12 aa) IQHRDLHAANILIKEDGSLSIIDYGYSN | |||| ||....|..| | | | .. IIHRDLKPSNIVVNQDCTLKICDFGHAR |
|||||||||
| Kinase | DDB0231335.AA | STE20 | 582-606 | 48 | 0.000176 | 12.63 | In-house | 140-164 (288) | Show / Hide |
Range on Protein: 582-606 Range on HMM: 140-164/288 Sequence Identity: 48% (12 aa) HRDLHAANILIKEDGSLSIIDYGYS |||. |.|||. |||. ..| |.. HRDIKADNILLTEDGEVKLADFGVC |
|||||||||
| Kinase | DDB0231335.AA | AGC-Unique | 580-609 | 53 | 0.000177 | 11.98 | In-house | 123-152 (270) | Show / Hide |
Range on Protein: 580-609 Range on HMM: 123-152/270 Sequence Identity: 53% (16 aa) IQHRDLHAANILIKEDGSLSIIDYGYSNIG | ||| |||| .|| . | ||| | | IIHRDIKPENILIDNDGHIMITDYGLSKTG |
|||||||||
| S_TKc | DDB0231335.AA | S_TKc | 355-751 | 8 | 0.000363 | -115.81 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 355-751
Range on HMM: 1-231/231
Sequence Identity: 8% (36 aa)
IQFDALQSNGMNGIVKSGTIGS--MKVVVKFPNSYFNGIISTATINSTGSSEWSFGSSDNGGNNSNSNGNSDSNSNNDSNNNNNNNNNNNNNNNNNNNNN
.. . | | |. .. . .| .| .
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK-------------------------------------------------------------------
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNSDGSSGDDNRNSDNLIKSDLIDECFLNETVSHLLINEFQINNTPSIVGIGI---NMIVMEKVDG
| ...| . . | . .. .||| .||
----------------------------------------------------------EHIRREIQILKK----HHPNIVKLYDVFQDDHLYMVMEYCDG
--TELEKYDKTK-----------LTKKIFMDLVIYLMEMNIFEIQHRDLHAANILIKEDGSLSIIDYGYSNIGDDRKGYDISNLKSIYY--------DF-
.| .| | . ..... .. | . | |||| .|||. | . |.| | . . . . .| ..
DLGDLFDYIKKRGRHGLRFPFPEHARFYMYQICCALEYCHSHGIIHRDLKPENILLDE--HIKICDFGLARQL-------TTFCGTPWYMAPEVLGYGKC
--------------------FNNYDTINHDKKEKIKNVFNYLNLNLNSNSNLNLNLNLYSNSNPNSNPNSNPNPKSNLNLNSNSNSNPNPNLNSYSNSHS
| . .. .|..
KCDWWSCGCILYEMLCGYPPFP-------QMQMMFKKIG-------------------------------------------------------------
NSNSNLNSNQKILIDLLNILIE-DEEILIPIHSKSY--NDERQIEYI
. ..|... . . | | . . | .. ...
---------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||