Gene 31627 (M.brevicollis)

31627

Species: M.brevicollis
Alias: 31627
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: Glyco

Sequence

Name Sequence Type Origin Length Description Download
31627.AA Protein None 866 None Fasta, JSON

Protein domain

Protein domains of 31627.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 31627.AA SH2 28-137 17 6.9e-05 17.8 SMART 1-87 (87) Show / Hide 
Range on Protein: 28-137
Range on HMM: 1-87/87
Sequence Identity: 17% (19 aa)

PDHFHGPISREEVVHRIANTSDNPEVGTFLLRVKEPQTQGQEVVFCISSVVESSSSGKPLGQRILHFLTFFDSRGRFRVVGRAKGQNTDQVFLFNDMEEV
   .||.|||||...   |    .. |.||.|  |.    .   ...|  ..         ... |.. . .  |.... .            |..  | 
QPWYHGNISREEAEQLLKNP--GMPDGDFLVRDSES----NPGDYVLSVRWK---------GKVKHYRIRRNDDGKYYIDET-------WRRKFPSL-EL

LDRCDSSSNG
..     . |
VNHYQHNPLG