Gene 30425 (M.brevicollis)

30425

Species: M.brevicollis
Alias: 30425
External Links:
Annotation:

Classification

Group: TK-assoc
Family: SH2
Subfamily: SH2D4

Sequence

Name Sequence Type Origin Length Description Download
30425.AA Protein None 476 None Fasta, JSON

Protein domain

Protein domains of 30425.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
SH2 30425.AA SH2 370-446 39 5e-26 78.25 Pfam 1-81 (81) Show / Hide 
Range on Protein: 370-446
Range on HMM: 1-81/81
Sequence Identity: 39% (33 aa)

WFHGPISRPEAERLLKG--KPKGAFLLRISTRIW-GYTLSFVDSD---RYKHFLVDASDGK-YSVFGAQSNATHMSLSRLVAFH
|.||.||| ||||||.   .| |.||.| | .   .||||..| .   | ||. .   |.. | ..| .    . ||. || ..
WYHGKISRQEAERLLMNPGNPDGTFLVRESESTPGDYTLSVRDDGPGDRVKHYRIQRTDNGGYYITGRHK---FCSLQELVEHY
SH2 30425.AA SH2 368-452 34 3.8e-24 87.45 SMART 1-87 (87) Show / Hide 
Range on Protein: 368-452
Range on HMM: 1-87/87
Sequence Identity: 34% (31 aa)

ENWFHGPISRPEAERLLKG--KPKGAFLLRISTR-IWGYTLSFVDSDRYKHFLVDASD-GKYSVFGAQSNATHMSLSRLVAFHKKVAVS
..|.||.||| |||.|||.  .| |.||.| | . . .|.||. . ...||...  .| |||.. .  .. .. ||  ||..... . .
QPWYHGNISREEAEQLLKNPGMPDGDFLVRDSESNPGDYVLSVRWKGKVKHYRIRRNDDGKYYIDET-WRRKFPSL-ELVNHYQHNPLG