Gene CC1G_09816 (C.cinerea)
CC1G_09816
Species: C.cinerea
Alias: CC1G_09816
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_09816.AA | Protein | None | 398 | None | Fasta, JSON |
| CC1G_09816.NA | RNA | None | 1197 | None | Fasta, JSON |
| CC1G_09816.kin_dom | Protein Kinase Domain | None | 281 | None | Fasta, JSON |
Protein domains of CC1G_09816.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CC1G_09816.AA | HMTK | 208-245 | 31 | 1.7e-07 | 22.33 | In-house | 122-158 (291) | Show / Hide |
Range on Protein: 208-245 Range on HMM: 122-158/291 Sequence Identity: 31% (12 aa) GLSFSTVEQLLLMTDQLLEGMVFLHQQRIAHRDVDTRN .. ....||| ... |...||.....|| |.|. .|| NIQLTYHEQLYFCV-QCASGMAYIASQRMVHMDLAARN |
|||||||||
| Kinase | CC1G_09816.AA | CDC2 | 223-240 | 61 | 2e-06 | 15.25 | In-house | 111-128 (301) | Show / Hide |
Range on Protein: 223-240 Range on HMM: 111-128/301 Sequence Identity: 61% (11 aa) QLLEGMVFLHQQRIAHRD |.|.|. |.||.|| ||| QILQGVHFCHQRRIMHRD |
|||||||||
| Kinase | CC1G_09816.AA | Ack | 210-245 | 33 | 3e-06 | 17.03 | In-house | 100-135 (266) | Show / Hide |
Range on Protein: 210-245 Range on HMM: 100-135/266 Sequence Identity: 33% (12 aa) SFSTVEQLLLMTDQLLEGMVFLHQQRIAHRDVDTRN .| .. |. |. .|| .|...|. |||. .|| AFFLIHTLCDFCMQIAMGMRYLEMKRCIHRDLAARN |
|||||||||
| Kinase | CC1G_09816.AA | Trk | 213-245 | 42 | 3e-06 | 17.02 | In-house | 115-147 (275) | Show / Hide |
Range on Protein: 213-245 Range on HMM: 115-147/275 Sequence Identity: 42% (14 aa) TVEQLLLMTDQLLEGMVFLHQQRIAHRDVDTRN |..|.| | |||.. .| . ||| ||| TIDQMLWIAKQIASGMVYMASQHFVHRDMATRN |
|||||||||
| Kinase | CC1G_09816.AA | NZAK | 224-249 | 34 | 7e-06 | 15.29 | In-house | 114-139 (329) | Show / Hide |
Range on Protein: 224-249 Range on HMM: 114-139/329 Sequence Identity: 34% (9 aa) LLEGMVFLHQQRIAHRDVDTRNMVMN . |.| .||.. | |||. . |.... IAETMSYLHKHHIIHRDIKSNNVILD |
|||||||||
| Kinase | CC1G_09816.AA | TK | 213-245 | 38 | 1.2e-05 | 14.05 | In-house | 233-270 (486) | Show / Hide |
Range on Protein: 213-245 Range on HMM: 233-270/486 Sequence Identity: 38% (15 aa) TVEQLLLMTDQLLEGMVFLHQQ------RIAHRDVDTRN |..||| | |. .|| .||.. .. |||. .|| TMHQLL-MCWQIACGMEYLHSKNCEFIQNFVHRDLAARN |
|||||||||
| Kinase | CC1G_09816.AA | ASK | 221-255 | 40 | 1.2e-05 | 14.53 | In-house | 100-134 (254) | Show / Hide |
Range on Protein: 221-255 Range on HMM: 100-134/254 Sequence Identity: 40% (14 aa) TDQLLEGMVFLHQQRIAHRDVDTRNMVMNALFEVC | |.|||. .||...| |||. |...| |. TKQILEGLKYLHENQIVHRDIKGDNVLVNTYSGVV |
|||||||||
| Kinase | CC1G_09816.AA | Ciliate-E9 | 223-250 | 34 | 1.2e-05 | 13.65 | In-house | 119-147 (298) | Show / Hide |
Range on Protein: 223-250 Range on HMM: 119-147/298 Sequence Identity: 34% (10 aa) QLLEGMVFLHQQR-IAHRDVDTRNMVMNA ||... ..||.. | |||. ||.... QLIDSIEYMHQYQNICHRDLKPENMLIDK |
|||||||||
| Kinase | CC1G_09816.AA | CDK | 223-240 | 50 | 1.3e-05 | 13.8 | In-house | 116-133 (284) | Show / Hide |
Range on Protein: 223-240 Range on HMM: 116-133/284 Sequence Identity: 50% (9 aa) QLLEGMVFLHQQRIAHRD |||.|. ..|...| ||| QLLRGLHYCHSNWIMHRD |
|||||||||
| Kinase | CC1G_09816.AA | PLK2 | 223-254 | 43 | 3.2e-05 | 12.44 | In-house | 111-142 (257) | Show / Hide |
Range on Protein: 223-254 Range on HMM: 111-142/257 Sequence Identity: 43% (14 aa) QLLEGMVFLHQQRIAHRDVDTRNMVMNALFEV |...|. .||||.| ||| |. .| || QIVSGLRYLHQQCIIHRDLKLGNFFINDNMEV |
|||||||||