Gene CC1G_15858 (C.cinerea)
CC1G_15858
Species: C.cinerea
Alias: CC1G_15858
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_15858.AA | Protein | None | 433 | None | Fasta, JSON |
| CC1G_15858.NA | RNA | None | 1302 | None | Fasta, JSON |
| CC1G_15858.kin_dom | Protein Kinase Domain | None | 292 | None | Fasta, JSON |
Protein domains of CC1G_15858.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| S_TKc | CC1G_15858.AA | S_TKc | 95-340 | 14 | 1.2e-07 | -64.59 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 95-340
Range on HMM: 1-231/231
Sequence Identity: 14% (43 aa)
EDEPDLAAVEESGSVVFAQDQQ-GHQVAIKLVPNDSDEIRIYRLIYAQDIETLKERCILPVLNILSSTTHSFVVMPRWGA-------YPIDPAL------
. .. |.| ... |..|||| .. . || . | . . | . . . .| ..|| . | .
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK---EHIRREIQILKK-----HHPNIVKLYDVFQD-DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFP
ASLSELVEFIHCLLKGLVFLHKNNIAHRDISFRNIVMNHFSSQPSMYANEARRKLRGDKLASYAIIDYNISVIAPEGVERSKFL-----LPAELSRDSAN
. . ... ....| ..|...| |||. || ... |.| .. . . | .. |.
FPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE----------------------HIKICDFGLARQL------TTFCGTPWYMAPEVL-----
GVPDTEQGELDYDPFAWDVGTLGAILSTQYQYFCGDLPLL--------------APLLDSMTTRDVSRRFTAAQALE---------FF
|.... |. .| || | .|| | ... . ..| ..| || .||. .|
----------GYGKCKCDWWSCGCIL---YEMLCGYPPFPQMQMMFKKIGSPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | CC1G_15858.AA | Ciliate-E2-Unclassified | 182-218 | 30 | 6.3e-07 | 20.09 | In-house | 136-178 (352) | Show / Hide |
Range on Protein: 182-218 Range on HMM: 136-178/352 Sequence Identity: 30% (13 aa) SLSELV-----EFIHCLLKGLVFLHKNN-IAHRDISFRNIVMN . . . .. ..|.|| .||..| | |||| ||... TEQQAKYKKAKFYFAQILQGLEYLHHKNNIIHRDIKPENILFD |
|||||||||
| Kinase | CC1G_15858.AA | NZAK | 184-218 | 28 | 1e-06 | 17.74 | In-house | 105-139 (329) | Show / Hide |
Range on Protein: 184-218 Range on HMM: 105-139/329 Sequence Identity: 28% (10 aa) SELVEFIHCLLKGLVFLHKNNIAHRDISFRNIVMN .. . | . ... .||| | |||| |.... HRIIKMIADIAETMSYLHKHHIIHRDIKSNNVILD |
|||||||||
| Kinase | CC1G_15858.AA | Ciliate-E2 | 189-217 | 43 | 9e-06 | 15.83 | In-house | 165-194 (365) | Show / Hide |
Range on Protein: 189-217 Range on HMM: 165-194/365 Sequence Identity: 43% (13 aa) FIHCLLKGLVFLHKNN-IAHRDISFRNIVM .| |....| .||..| | |||| ||.. YIACIILALEYLHSKNNIIHRDIKPENILF |
|||||||||
| Kinase | CC1G_15858.AA | DYRK2 | 182-209 | 53 | 1e-05 | 14.22 | In-house | 100-127 (318) | Show / Hide |
Range on Protein: 182-209 Range on HMM: 100-127/318 Sequence Identity: 53% (15 aa) SLSELVEFIHCLLKGLVFLHKNNIAHRD ||.. |.| .|..|.||||||| | | SLQLVRRFAHSILQCLRFLHKNNIIHCD |
|||||||||
| Kinase | CC1G_15858.AA | Ciliate-A9 | 190-210 | 33 | 1e-05 | 8.71 | In-house | 131-151 (392) | Show / Hide |
Range on Protein: 190-210 Range on HMM: 131-151/392 Sequence Identity: 33% (7 aa) IHCLLKGLVFLHKNNIAHRDI . |........| .|| |||. MKCIMSAVMYMHQKNICHRDL |
|||||||||
| Kinase | CC1G_15858.AA | MKC | 193-218 | 53 | 1.1e-05 | 17.58 | In-house | 111-136 (260) | Show / Hide |
Range on Protein: 193-218 Range on HMM: 111-136/260 Sequence Identity: 53% (14 aa) LLKGLVFLHKNNIAHRDISFRNIVMN .|.|| ||..||.|||. || || MLQGLMYLHEHNIVHRDLKSANIMMN |
|||||||||
| Kinase | CC1G_15858.AA | Ciliate-A1 | 185-218 | 32 | 1.3e-05 | 14.95 | In-house | 102-135 (301) | Show / Hide |
Range on Protein: 185-218 Range on HMM: 102-135/301 Sequence Identity: 32% (11 aa) ELVEFIHCLLKGLVFLHKNNIAHRDISFRNIVMN | .|. . .|.. .|. || |||. ||... EIYEICYQIIEGYADIHDHNILHRDLKPQNILIH |
|||||||||
| Kinase | CC1G_15858.AA | STE20 | 193-210 | 61 | 1.4e-05 | 16.73 | In-house | 126-143 (288) | Show / Hide |
Range on Protein: 193-210 Range on HMM: 126-143/288 Sequence Identity: 61% (11 aa) LLKGLVFLHKNNIAHRDI .|.|| .||.|.| |||| VLQGLDYLHSNHIIHRDI |
|||||||||
| Kinase | CC1G_15858.AA | MST | 194-219 | 53 | 7.6e-05 | 11.25 | In-house | 107-132 (254) | Show / Hide |
Range on Protein: 194-219 Range on HMM: 107-132/254 Sequence Identity: 53% (14 aa) LKGLVFLHKNNIAHRDISFRNIVMNH |.|| ||.| . |||| || .|| LQGLQYLHDNKKIHRDIKAGNILLNH |
|||||||||
| Kinase | CC1G_15858.AA | CRK7 | 193-218 | 53 | 0.000119 | 11.73 | In-house | 121-146 (343) | Show / Hide |
Range on Protein: 193-218 Range on HMM: 121-146/343 Sequence Identity: 53% (14 aa) LLKGLVFLHKNNIAHRDISFRNIVMN || |. .||.|. |||| || || LLEGMDYCHKKNFLHRDIKCSNILMN |
|||||||||
| Kinase | CC1G_15858.AA | Pkinase | 185-210 | 34 | 0.001045 | 14.19 | Pfam | 109-134 (293) | Show / Hide |
Range on Protein: 185-210 Range on HMM: 109-134/293 Sequence Identity: 34% (9 aa) ELVEFIHCLLKGLVFLHKNNIAHRDI |. .. .|.|| ..|...| |||. ECKFYMYQILRGLEYCHSMGIIHRDL |
|||||||||
| Kinase | CC1G_15858.AA | CRK7 | 318-340 | 44 | 0.003369 | 6.65 | In-house | 319-343 (343) | Show / Hide |
Range on Protein: 318-340 Range on HMM: 319-343/343 Sequence Identity: 44% (11 aa) LLDSMTTRDVSRRFTAAQAL--EFF ||| | . | . |||| ..| ..| LLDKMLCLDPKKRFTAEECLQHDWF |
|||||||||
| Kinase | CC1G_15858.AA | MST | 115-134 | 46 | 0.010925 | 4.28 | In-house | 22-47 (254) | Show / Hide |
Range on Protein: 115-134 Range on HMM: 22-47/254 Sequence Identity: 46% (12 aa) QQGHQVAIKLVPNDSD------EIRI | |. ||||.||...| ||.| QTGKIVAIKMVPVNEDLQEIIKEISI |
|||||||||
| Kinase | CC1G_15858.AA | Pkinase | 318-340 | 28 | 0.204172 | 6.09 | Pfam | 269-293 (293) | Show / Hide |
Range on Protein: 318-340 Range on HMM: 269-293/293 Sequence Identity: 28% (7 aa) LLDSMTTRDVSRRFTAAQALEF--F ..... ..| ..| ||.|.|. | FIKWCLCKDPKKRPTAEQILQHPWF |
|||||||||