Gene CC1G_15590 (C.cinerea)
CC1G_15590
Species: C.cinerea
Alias: CC1G_15590
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_15590.AA | Protein | None | 430 | None | Fasta, JSON |
| CC1G_15590.NA | RNA | None | 1293 | None | Fasta, JSON |
| CC1G_15590.kin_dom | Protein Kinase Domain | None | 295 | None | Fasta, JSON |
Protein domains of CC1G_15590.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CC1G_15590.AA | Ciliate-A9 | 192-212 | 33 | 1.5e-08 | 15.6 | In-house | 131-151 (392) | Show / Hide |
Range on Protein: 192-212 Range on HMM: 131-151/392 Sequence Identity: 33% (7 aa) IRCLLKGLVFLHKNNIVHRDI ..|........| .||.|||. MKCIMSAVMYMHQKNICHRDL |
|||||||||
| Kinase | CC1G_15590.AA | Ciliate-E2-Unclassified | 184-220 | 30 | 1.2e-07 | 22.64 | In-house | 136-178 (352) | Show / Hide |
Range on Protein: 184-220 Range on HMM: 136-178/352 Sequence Identity: 30% (13 aa) SLSELV-----VFIRCLLKGLVFLHKNN-IVHRDISFRNIVMN . . . .....|.|| .||..| |.|||| ||... TEQQAKYKKAKFYFAQILQGLEYLHHKNNIIHRDIKPENILFD |
|||||||||
| Kinase | CC1G_15590.AA | STE | 186-212 | 46 | 2.4e-07 | 22.1 | In-house | 151-178 (359) | Show / Hide |
Range on Protein: 186-212 Range on HMM: 151-178/359 Sequence Identity: 46% (13 aa) SELVVFIRCLLKG-LVFLHKNNIVHRDI |.. ...| .||| | .||...|.|||| SQIAYICRQILKGLLYYLHSHHIIHRDI |
|||||||||
| Kinase | CC1G_15590.AA | Ciliate-E2 | 191-219 | 43 | 5.9e-07 | 19.89 | In-house | 165-194 (365) | Show / Hide |
Range on Protein: 191-219 Range on HMM: 165-194/365 Sequence Identity: 43% (13 aa) FIRCLLKGLVFLHKNN-IVHRDISFRNIVM .|.|....| .||..| |.|||| ||.. YIACIILALEYLHSKNNIIHRDIKPENILF |
|||||||||
| Kinase | CC1G_15590.AA | NZAK | 186-220 | 28 | 7.4e-07 | 18.52 | In-house | 105-139 (329) | Show / Hide |
Range on Protein: 186-220 Range on HMM: 105-139/329 Sequence Identity: 28% (10 aa) SELVVFIRCLLKGLVFLHKNNIVHRDISFRNIVMN .. . | . ... .||| |.|||| |.... HRIIKMIADIAETMSYLHKHHIIHRDIKSNNVILD |
|||||||||
| Kinase | CC1G_15590.AA | ASK | 193-223 | 48 | 1e-06 | 17.63 | In-house | 101-131 (254) | Show / Hide |
Range on Protein: 193-223 Range on HMM: 101-131/254 Sequence Identity: 48% (15 aa) RCLLKGLVFLHKNNIVHRDISFRNIVMNHFS . .|.|| .|| |.|||||| |...| .| KQILEGLKYLHENQIVHRDIKGDNVLVNTYS |
|||||||||
| S_TKc | CC1G_15590.AA | S_TKc | 102-342 | 12 | 2e-06 | -82.91 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 102-342 Range on HMM: 1-231/231 Sequence Identity: 12% (37 aa) LAAIEE-----SGSLVFAQDQQ-GHHVAIKLVPNDSDEIRIYELIHARDHETLKEQCTLPVLDILSSTTHSFVVMPRWGA-------HPIDPAL------ ... |. ... |..|||| .. . . . .. . .|. . .| ..|| . . . YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK-------EHIRREIQILKK-HHPNIVKLYDVFQD-DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFP ASLSELVVFIRCLLKGLVFLHKNNIVHRDISFRNIVMNHFSSHTSMYANEARRKLRRDQMASYAFIDYNISVIAPDGVERSKFRLPAELSRDSSDGVPD- . . ... ....| ..|...|.|||. || ... .| .. . .. | |. FPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE----------------------HIKICDFGLARQL-----------------TTFCGTPWY --TEQGELDYDPFAYDVGTLGAMLSTQYQYFCGDLPLL--------------APLFDSMTTRDVSRRFTAAQALE---------FF | |.... |. .| .| | .|| | . . . ..| ..| || .||. .| MAPEVL--GYGKCKCDWWSCGCIL---YEMLCGYPPFPQMQMMFKKIGSPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF |
|||||||||
| Kinase | CC1G_15590.AA | CAMK | 191-212 | 36 | 2e-06 | 16.24 | In-house | 184-205 (425) | Show / Hide |
Range on Protein: 191-212 Range on HMM: 184-205/425 Sequence Identity: 36% (8 aa) FIRCLLKGLVFLHKNNIVHRDI ..| .. .. ..|..||||||. YFRQICSAVHYCHSHNIVHRDL |
|||||||||
| Kinase | CC1G_15590.AA | STE11-Unclassified | 195-212 | 55 | 2e-06 | 19.24 | In-house | 116-133 (308) | Show / Hide |
Range on Protein: 195-212 Range on HMM: 116-133/308 Sequence Identity: 55% (10 aa) LLKGLVFLHKNNIVHRDI .|.|| .||...|.|||| ILEGLAYLHSHGIIHRDI |
|||||||||
| Kinase | CC1G_15590.AA | CRK7 | 184-220 | 43 | 6e-06 | 16.39 | In-house | 110-146 (343) | Show / Hide |
Range on Protein: 184-220 Range on HMM: 110-146/343 Sequence Identity: 43% (16 aa) SLSELVVFIRCLLKGLVFLHKNNIVHRDISFRNIVMN |.... | . || |. .||.|. |||| || || SHQQCKCFMKQLLEGMDYCHKKNFLHRDIKCSNILMN |
|||||||||
| Kinase | CC1G_15590.AA | MST | 196-221 | 53 | 9e-06 | 14.28 | In-house | 107-132 (254) | Show / Hide |
Range on Protein: 196-221 Range on HMM: 107-132/254 Sequence Identity: 53% (14 aa) LKGLVFLHKNNIVHRDISFRNIVMNH |.|| ||.| ..|||| || .|| LQGLQYLHDNKKIHRDIKAGNILLNH |
|||||||||
| Kinase | CC1G_15590.AA | Pkinase | 187-212 | 34 | 0.0001 | 17.79 | Pfam | 109-134 (293) | Show / Hide |
Range on Protein: 187-212 Range on HMM: 109-134/293 Sequence Identity: 34% (9 aa) ELVVFIRCLLKGLVFLHKNNIVHRDI |. ... .|.|| ..|...|.|||. ECKFYMYQILRGLEYCHSMGIIHRDL |
|||||||||
| Kinase | CC1G_15590.AA | MST | 117-136 | 46 | 0.008098 | 4.7 | In-house | 22-47 (254) | Show / Hide |
Range on Protein: 117-136 Range on HMM: 22-47/254 Sequence Identity: 46% (12 aa) QQGHHVAIKLVPNDSD------EIRI | |. ||||.||...| ||.| QTGKIVAIKMVPVNEDLQEIIKEISI |
|||||||||
| Kinase | CC1G_15590.AA | CRK7 | 320-342 | 40 | 0.012065 | 4.71 | In-house | 319-343 (343) | Show / Hide |
Range on Protein: 320-342 Range on HMM: 319-343/343 Sequence Identity: 40% (10 aa) LFDSMTTRDVSRRFTAAQAL--EFF |.| | . | . |||| ..| ..| LLDKMLCLDPKKRFTAEECLQHDWF |
|||||||||
| Kinase | CC1G_15590.AA | Pkinase | 326-342 | 36 | 1.728297 | 2.81 | Pfam | 275-293 (293) | Show / Hide |
Range on Protein: 326-342 Range on HMM: 275-293/293 Sequence Identity: 36% (7 aa) TRDVSRRFTAAQALEF--F ..| ..| ||.|.|. | CKDPKKRPTAEQILQHPWF |
|||||||||