Gene CC1G_15857 (C.cinerea)
CC1G_15857
Species: C.cinerea
Alias: CC1G_15857
External Links:
Annotation:
Sequence
Name | Sequence Type | Origin | Length | Description | Download |
---|---|---|---|---|---|
CC1G_15857.AA | Protein | None | 439 | None | Fasta, JSON |
CC1G_15857.NA | RNA | None | 1320 | None | Fasta, JSON |
CC1G_15857.kin_dom | Protein Kinase Domain | None | 303 | None | Fasta, JSON |
Protein domains of CC1G_15857.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
---|---|---|---|---|---|---|---|---|---|
S_TKc | CC1G_15857.AA | S_TKc | 97-350 | 16 | 2.4e-09 | -39.9 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 97-350 Range on HMM: 1-231/231 Sequence Identity: 16% (48 aa) EDELDLVACEQSGSLVFAQDEQ-GRHVAIKLVPNGSDELRIYELIHAQDVESLKEHCILPILEILRSTTHSFVVMPRWGGDPITPPLASLLEVLA----- . |... |. ... ||.|||| .. | . |. . . | .... .. .| ..|| .|| | .|.... YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK----EHIRREIQILKK----HHPNIVKLYDVFQD-DHLYMVMEYCDGD-----LGDLFDYIKKRGRH -----FIHCLLKNYIYIFFQALAFLHKNNIVHRDISTANIVTNHFSTHESMWASEPRKQLRREQLASYALIDFNYSAIVPDGVEPSKFRLPAEKAFDAAY | . |.| ..||...|...|.|||. .|| .. ..|| .... | GLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE----------------------HIKICDFGLARQL------------TTFCGTPWY AVPDTAQGEVDYDPFAWDVCSLGAL---MATQYQYFCYDLPF---------LAPLFDSMITIDVSRRFTAAQALE---------FF | |.... |. |.| . |.. | |. .. . . . . . | ..| || .||. .| MAPEVL----GYGKCKCDWWSCGCILYEMLCGYPPFP-QMQMMFKKIGSPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF |
|||||||||
Kinase | CC1G_15857.AA | CDC7 | 197-220 | 45 | 9e-09 | 20.8 | In-house | 111-134 (522) | Show / Hide |
Range on Protein: 197-220 Range on HMM: 111-134/522 Sequence Identity: 45% (11 aa) KNYIYIFFQALAFLHKNNIVHRDI | |.| | ||...|...|.|||. KHYMYNLFYALRHVHQFGIIHRDV |
|||||||||
Kinase | CC1G_15857.AA | NEK8 | 206-225 | 50 | 9.9e-08 | 18.02 | In-house | 131-150 (278) | Show / Hide |
Range on Protein: 206-225 Range on HMM: 131-150/278 Sequence Identity: 50% (10 aa) ALAFLHKNNIVHRDISTANI |....|..||.|||. |.|| AVHHMHQHNILHRDLKTQNI |
|||||||||
Kinase | CC1G_15857.AA | CDKL | 195-220 | 38 | 9.3e-07 | 19.13 | In-house | 99-124 (286) | Show / Hide |
Range on Protein: 195-220 Range on HMM: 99-124/286 Sequence Identity: 38% (10 aa) LLKNYIYIFFQALAFLHKNNIVHRDI ....|.. .|..|.||.|..|||| VVRKYMWQILKAINFCHKHNCIHRDI |
|||||||||
Kinase | CC1G_15857.AA | Aur | 206-220 | 60 | 1e-06 | 13.17 | In-house | 113-127 (257) | Show / Hide |
Range on Protein: 206-220 Range on HMM: 113-127/257 Sequence Identity: 60% (9 aa) ALAFLHKNNIVHRDI || ..|..||.|||| ALDYCHSKNIIHRDI |
|||||||||
Kinase | CC1G_15857.AA | CDK-Unclassified | 194-232 | 42 | 2e-06 | 17.36 | In-house | 121-160 (324) | Show / Hide |
Range on Protein: 194-232 Range on HMM: 121-160/324 Sequence Identity: 42% (17 aa) CLLKNYIYIFFQALAFLHKNNIVHRDISTANI-VTNHFST | .|. .. .|.|| | | |||| ..|| .|| .|| CQIRNFMHQMLEGIAYLHCNKIMHRDIKPQNIMITNNNST |
|||||||||
Kinase | CC1G_15857.AA | RCK | 196-221 | 42 | 2e-06 | 16.09 | In-house | 107-132 (298) | Show / Hide |
Range on Protein: 196-221 Range on HMM: 107-132/298 Sequence Identity: 42% (11 aa) LKNYIYIFFQALAFLHKNNIVHRDIS .||..| .|.||..||... |||.. IKNIMYQILQGLAHMHKHGFFHRDLK |
|||||||||
Kinase | CC1G_15857.AA | STE20 | 205-225 | 57 | 2e-06 | 19.82 | In-house | 128-148 (288) | Show / Hide |
Range on Protein: 205-225 Range on HMM: 128-148/288 Sequence Identity: 57% (12 aa) QALAFLHKNNIVHRDISTANI |.|..||.|.|.|||| .|| QGLDYLHSNHIIHRDIKADNI |
|||||||||
Kinase | CC1G_15857.AA | YSK | 205-225 | 42 | 2e-06 | 14.9 | In-house | 110-130 (257) | Show / Hide |
Range on Protein: 205-225 Range on HMM: 110-130/257 Sequence Identity: 42% (9 aa) QALAFLHKNNIVHRDISTANI ..| .||... .|||| ||. KGLDYLHSERKIHRDIKAANV |
|||||||||
Kinase | CC1G_15857.AA | CAMK1 | 204-220 | 41 | 5e-06 | 13.5 | In-house | 118-134 (276) | Show / Hide |
Range on Protein: 204-220 Range on HMM: 118-134/276 Sequence Identity: 41% (7 aa) FQALAFLHKNNIVHRDI ..|. ..|...|||||. LSAVEYMHSKGIVHRDL |
|||||||||
Kinase | CC1G_15857.AA | CRK7 | 207-228 | 45 | 0.000137 | 11.52 | In-house | 125-146 (343) | Show / Hide |
Range on Protein: 207-228 Range on HMM: 125-146/343 Sequence Identity: 45% (10 aa) LAFLHKNNIVHRDISTANIVTN .. .||.|. |||| .|| | MDYCHKKNFLHRDIKCSNILMN |
|||||||||
Kinase | CC1G_15857.AA | CRK7 | 328-350 | 40 | 0.0003 | 10.33 | In-house | 319-343 (343) | Show / Hide |
Range on Protein: 328-350 Range on HMM: 319-343/343 Sequence Identity: 40% (10 aa) LFDSMITIDVSRRFTAAQAL--EFF |.| | . | . |||| ..| ..| LLDKMLCLDPKKRFTAEECLQHDWF |
|||||||||
Kinase | CC1G_15857.AA | Pkinase | 204-220 | 35 | 0.00239 | 12.92 | Pfam | 118-134 (293) | Show / Hide |
Range on Protein: 204-220 Range on HMM: 118-134/293 Sequence Identity: 35% (6 aa) FQALAFLHKNNIVHRDI ...|...|...|.|||. LRGLEYCHSMGIIHRDL |
|||||||||
Kinase | CC1G_15857.AA | CAMK1 | 332-348 | 35 | 0.032185 | 2.18 | In-house | 256-272 (276) | Show / Hide |
Range on Protein: 332-348 Range on HMM: 256-272/276 Sequence Identity: 35% (6 aa) MITIDVSRRFTAAQALE |.. | . |.|..|.|. MLEVDPKKRYTCEQCLN |
|||||||||
Kinase | CC1G_15857.AA | Pkinase | 330-350 | 30 | 0.352828 | 5.25 | Pfam | 271-293 (293) | Show / Hide |
Range on Protein: 330-350 Range on HMM: 271-293/293 Sequence Identity: 30% (7 aa) DSMITIDVSRRFTAAQALEF--F ..... | ..| ||.|.|. | KWCLCKDPKKRPTAEQILQHPWF |