Gene CC1G_07032 (C.cinerea)

CC1G_07032

Species: C.cinerea
Alias: CC1G_07032
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_07032.AA Protein None 855 None Fasta, JSON
CC1G_07032.NA RNA None 2568 None Fasta, JSON
CC1G_07032.kin_dom Protein Kinase Domain None 474 None Fasta, JSON

Protein domain

Protein domains of CC1G_07032.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Kinase CC1G_07032.AA TKL 550-607 25 0.000413 10.71 In-house 162-244 (364) Show / Hide 
Range on Protein: 550-607
Range on HMM: 162-244/364
Sequence Identity: 25% (21 aa)

VHRDISTGNILAHRS---------APGAPWRVKLSDLEYAKRFP--GNPTATASTEV--------------KTGTMYFMATEV
.|||. . ||| ..          .| |.|..|..|.  ....   || ..|..|.               . || ..|| ||
IHRDLKSKNILVDENWTNVSNYMYNPNADWCCKICDFGLSRFMSQSGNMNDTMTTMMESAEHQNNRKTTMTQCGTPRWMAPEV
Kinase CC1G_07032.AA Ciliate-E2 550-611 19 0.000681 9.23 In-house 183-262 (365) Show / Hide 
Range on Protein: 550-611
Range on HMM: 183-262/365
Sequence Identity: 19% (18 aa)

VHRDISTGNILAHRSAPGAPWRVKLSDLEYAKR------------------FPGNPTATASTEV-----------KTGTMYFMATEVQQSQ
.||||   |||           .|..|. ..|.                  | .| | . ..               || ..|| |. ...
IHRDIKPENILF----------IKIIDFGLSKKYDDDNQNRTHKQQCKWYMF-KNDTSRTPGYMDQIIQQNMFNTICGTPGYMAPEILNGK