Gene CC1G_12646 (C.cinerea)

CC1G_12646

Species: C.cinerea
Alias: CC1G_12646
External Links:
Annotation:

Classification

Group: Other
Family: FunK1

Sequence

Name Sequence Type Origin Length Description Download
CC1G_12646.AA Protein None 735 None Fasta, JSON
CC1G_12646.NA RNA None 2208 None Fasta, JSON
CC1G_12646.kin_dom Protein Kinase Domain None 410 None Fasta, JSON

Protein domain

Protein domains of CC1G_12646.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
S_TKc CC1G_12646.AA S_TKc 285-532 11 0.00035 -115.58 SMART 1-231 (231) Show / Hide 
Range on Protein: 285-532
Range on HMM: 1-231/231
Sequence Identity: 11% (35 aa)

VTLDNHVRTEADAQQQLFRDIIAVSRDEAWRSREILKDFPKHHLDSLAEALRDDNYKKFFSCIIAKCIRPCTISPSLPHSNCTHKPKRRCFFVYELVCK-
 .. ...   | ..  . |..     ..     .|  .  .  .. | .  . .|  |.. ..                         . ..| |..   
YEILRKIGKGAFGKVYKCRHKK---TGRIVAIKIIK-EHIRREIQILKK--HHPNIVKLYDVFQD----------------------DHLYMVMEYCDGD

--PLSD------I------ATLGEAVDLLKQSLTALQIMFCAGWVHCDVSSGNILGFRTGQDARWQVKLSDLEFAKRFPPEGDGVVEESRMGTPQFMA--
   | |              .  .|  ...| . ||. .   | .|.|.   |||  .       ..|..|  .|...          .  ||| .||  
LGDLFDYIKKRGRHGLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE-------HIKICDFGLARQL---------TTFCGTPWYMAPE

------------------WELQSSRHFLPPTTEIGMARRTAHPKKPVVHNYQHDLEPLFWILLWLLTMRSK--LSPSRAFG-------DLFF
                  .|. . .   |  ..  | ..              . | .  ..  .|..  .  ..   |.        . .|
VLGYGKCKCDWWSCGCILYEMLCGYPPFP--QMQMMFKKIG------------SPEAKD-FIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF