Gene CC1G_15852 (C.cinerea)
CC1G_15852
Species: C.cinerea
Alias: CC1G_15852
External Links:
Annotation:
Group:
Other
Family:
Other-Unique
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CC1G_15852.AA | Protein | None | 426 | None | Fasta, JSON |
| CC1G_15852.NA | RNA | None | 1281 | None | Fasta, JSON |
| CC1G_15852.kin_dom | Protein Kinase Domain | None | 300 | None | Fasta, JSON |
Protein domains of CC1G_15852.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CC1G_15852.AA | MAPKAPK | 123-175 | 33 | 1.3e-05 | 12.9 | In-house | 126-182 (292) | Show / Hide |
Range on Protein: 123-175 Range on HMM: 126-182/292 Sequence Identity: 33% (20 aa) HRDISPGNILAYRESPGSPWTVKLSDLEHAKR------FPDPASTGAADSIIGTPYFIA |||. | ||| .. .| |||.|. ||. ..|..| . . .|||..| HRDLKPENILCTDTNHNCP--VKLCDFGFAKEIHLNHDCTTPITTPELMTPCYTPYYMA |
|||||||||
| Kinase | CC1G_15852.AA | Ciliate-E2 | 122-178 | 23 | 0.000119 | 11.87 | In-house | 183-258 (365) | Show / Hide |
Range on Protein: 122-178 Range on HMM: 183-258/365 Sequence Identity: 23% (20 aa) VHRDISPGNILAYRESPGSPWTVKLSDLEHAKRFPDP--------------------ASTG---------AADSIIGTPYFIAYEI .|||| | ||| .|..|. .|.. |. ..| ...|.|||.. | || IHRDIKPENILF----------IKIIDFGLSKKYDDDNQNRTHKQQCKWYMFKNDTSRTPGYMDQIIQQNMFNTICGTPGYMAPEI |
|||||||||
| Kinase | CC1G_15852.AA | CAMK | 122-175 | 20 | 0.000168 | 9.63 | In-house | 201-287 (425) | Show / Hide |
Range on Protein: 122-175 Range on HMM: 201-287/425 Sequence Identity: 20% (18 aa) VHRDISPGNILAYRESPGSP------------WTVKLSDLEHAKRF---------------------PDPASTGAADSIIGTPYFIA ||||. | ||| ...|. ...|..| |..| ..|... |||...| VHRDLKPENILLDDNNDDSDPVEHDEIFDWNNNNIKIIDFGFANKFDPGENNFMCSDYKGGEMHNQWTTPTEGQKMKTFCGTPEYMA |
|||||||||
| Kinase | CC1G_15852.AA | TAO | 109-178 | 34 | 0.000184 | 10.17 | In-house | 108-166 (254) | Show / Hide |
Range on Protein: 109-178 Range on HMM: 108-166/254 Sequence Identity: 34% (24 aa) VLIPLRLMFCAGWVHRDISPGNILAYRESPGSPWTVKLSDLEHAKRFPDPASTGAADSIIGTPYFIAYEI .| || . .|||| |||| .. .|||.| | . |.| .||||..| |. ALQGLRYLHSHKMIHRDIKAGNILLTEHG-----QVKLADFGSA------SMVCPANSFVGTPYWMAPEV |
|||||||||
| Kinase | CC1G_15852.AA | NEK6 | 122-177 | 37 | 0.00045 | 9.02 | In-house | 125-173 (252) | Show / Hide |
Range on Protein: 122-177 Range on HMM: 125-173/252 Sequence Identity: 37% (21 aa) VHRDISPGNILAYRESPGSPWTVKLSDLEHAKRFPDPASTGAADSIIGTPYFIAYE .|||| | |. . ||| || . | . | || |..||||... | MHRDIKPANVFITANG-----IVKLGDLGLGRFF--SSKTTAAHSLVGTPYYMSPE |
|||||||||