Gene AqueK485 (A.queenslandica)
AqueK485
Species: A.queenslandica
Alias: AqueK485
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| AqueK485.AA | Protein | None | 1884 | None | Fasta, JSON |
| AqueK485.kin_dom | Protein Kinase Domain | None | 69 | None | Fasta, JSON |
Protein domains of AqueK485.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Ras | AqueK485.AA | Ras | 71-137 | 24 | 2e-08 | 30.25 | Pfam | 76-146 (167) | Show / Hide |
Range on Protein: 71-137 Range on HMM: 76-146/167 Sequence Identity: 24% (18 aa) IILFDITSHETYMELSQLLEMSHRVCP---SAHVVVIGAKADLRK--PHHVTTEEAESFCSGHRNG-TPYYEI .. .|||..... .. . .| .|.|. . .. .| |.||. . |.|||.. |. ..| |..|. LLVYDITNRQSFENVKNWWEEIRRHCDKDDNVPIMLVGNKCDLEDDQQRQVSTEEGQAFA--KEWGACPFMEC |
|||||||||
| RAB | AqueK485.AA | RAB | 6-155 | 19 | 5.4e-07 | -55.34 | SMART | 1-172 (172) | Show / Hide |
Range on Protein: 6-155 Range on HMM: 1-172/172 Sequence Identity: 19% (36 aa) VIVAVFGCPGVGKSTFISNALEGQFERKREAGNQRYITGSVKMCGREVPVKIVEEPELTT-------------RAILS---------IILFDITSHETYM . . | ||||| ... ...|. . .. .| . .|..| . . |.| | |. .|||..|.. FKIILIGDSGVGKSCLLHRFTDDKFSEQYKHT-----------IGVDFKTKTIEVDGKRVKLQIWDTAGQERFRSITSSYYRGAHGCILVYDITNRESFE ELSQLLEMSHRVCPS----AHVVVIGAKADLRKPHHVTTEEAESFCS--GHRNGTPYY-E----IANGPTESISALFKEVLAR ... |. . ... ....| |.||.. .|.||||. || ..|.|.. | . .|. .| .....| NVKNWLKEIRMHANPPPENVVIMLVGNKCDLEHQRQVSTEEAQKFCCDCAEKHGMPFMFETSAKTNTNVEEAFQCLARKIYQR |
|||||||||
| Miro | AqueK485.AA | Miro | 8-31 | 41 | 0.009897 | 11.96 | Pfam | 2-25 (140) | Show / Hide |
Range on Protein: 8-31 Range on HMM: 2-25/140 Sequence Identity: 41% (10 aa) VAVFGCPGVGKSTFISNALEGQFE |.|.| .|.|||.||. .. ..|. VVVCGDKGCGKSSFIHQYCGEEFP |
|||||||||
| Miro | AqueK485.AA | Miro | 71-109 | 20 | 18.273992 | 0.3 | Pfam | 98-140 (140) | Show / Hide |
Range on Protein: 71-109 Range on HMM: 98-140/140 Sequence Identity: 20% (9 aa) IILFDITSHETYMELSQLLEMSHRVCPS----AHVVVIGAKAD ....| |..|.. ..| .. . .. |.|.| | | CFVYDCTDYESFNRVSNYMAWLPHFRKWGKKAIPVIVVGNKCD |
|||||||||
| LRR_1 | AqueK485.AA | LRR_1 | 266-288 | 37 | 57.981621 | 0.49 | Pfam | 1-26 (26) | Show / Hide |
Range on Protein: 266-288 Range on HMM: 1-26/26 Sequence Identity: 37% (10 aa) KTHLLQLSD-I--SLT-LIPSSFFQDL . | ||. .|| ||.| | | NLQHLDLSGCNCCNLTGHIPPSCF-NL |
|||||||||
| LRR_TYP | AqueK485.AA | LRR_TYP | 314-337 | 50 | 1.9e-05 | 25.31 | SMART | 1-24 (24) | Show / Hide |
Range on Protein: 314-337 Range on HMM: 1-24/24 Sequence Identity: 50% (12 aa) LPSLTYLNLSHNFLSSLPSYAHWG ||.|. |.||.| |..||. | .| LPNLRELDLSNNQLTHLPPGAFQG |
|||||||||
| LRR_1 | AqueK485.AA | LRR_1 | 316-336 | 25 | 0.004237 | 15.16 | Pfam | 1-26 (26) | Show / Hide |
Range on Protein: 316-336 Range on HMM: 1-26/26 Sequence Identity: 25% (7 aa) SLTYLNLSH-N--FLS-SLPS--YAHW .|..|.||. | |. ..|. . NLQHLDLSGCNCCNLTGHIPPSCF-NL |
|||||||||
| LRR_1 | AqueK485.AA | LRR_1 | 293-314 | 29 | 0.031924 | 12.05 | Pfam | 1-26 (26) | Show / Hide |
Range on Protein: 293-314 Range on HMM: 1-26/26 Sequence Identity: 29% (8 aa) SITHVDFSR-N--LLC-EIPVE-LCQL ...| |.|. | |. .|| . . .| NLQHLDLSGCNCCNLTGHIPPSCF-NL |
|||||||||
| LRR_1 | AqueK485.AA | LRR_1 | 340-354 | 33 | 1.243741 | 6.41 | Pfam | 1-18 (26) | Show / Hide |
Range on Protein: 340-354 Range on HMM: 1-18/26 Sequence Identity: 33% (6 aa) HLKVLNVSH-N--KLMGD .|..|..|. | .| |. NLQHLDLSGCNCCNLTGH |
|||||||||
| LRR_1 | AqueK485.AA | LRR_1 | 398-420 | 37 | 0.005493 | 14.76 | Pfam | 1-26 (26) | Show / Hide |
Range on Protein: 398-420 Range on HMM: 1-26/26 Sequence Identity: 37% (10 aa) ALMHLDLSG-N-TKI-KSLPPE-LGLM | |||||| | ... ...||. . . NLQHLDLSGCNCCNLTGHIPPSCF-NL |
|||||||||
| ROC | AqueK485.AA | ROC | 462-683 | 16 | 7.7e-21 | 66.92 | In-house | 1-215 (215) | Show / Hide |
Range on Protein: 462-683
Range on HMM: 1-215/215
Sequence Identity: 16% (45 aa)
ITSLRVVLVGPESVGKTSLVARLKGDPVDGINP----------TKGLE-VSEWKYKGD----VLRRNMVTFDLWDFTGSSRYKSVYSCFDCK-DSLHIAV
.......|.| . ||||||. .|..|. . .. |.| | . .|..... . ..| .||| | | . . | . |....|
CNEMKLMLCGQGGVGKTSLCKQLMHDKFSDCSCYSCDKGNHPTTHGIEPIQQWVLDCKDMMFRKKEDEIKFNVWDFGGQEIYHATHQFFLTNHRSVYLLV
FNINT-----GYS------E--IISWLSDIQSFSEER-------VPVLLVFTHLDSCQTRE------------VRESEKKSRSEWVKYNMSISKKPETSP
... | ... . .. ||. |.|.. . ||..|.||.| . . . . ..| .. . | |. .
WDCRTKCCDGQPEMIVRECNYELEYWLRFIKSRGPQSEHHCMQPSPVIIVGTHWDKVPRQDNKVYQHKQCCRMWQKLRNKFPNICHSW-MQIEHY-----
AFTLLASSMSQTVKSLQDIDGRSSAHERIQSSLDQMEFSGHIVPLMPLVITEPHFVSCTTG-EGISQLRKT
. . |.|.|| .||..||..
--------------------------------------------------QGFFHVDCETGCKGIDKLRHH
|
|||||||||
| Miro | AqueK485.AA | Miro | 466-484 | 31 | 0.00074 | 15.98 | Pfam | 1-19 (140) | Show / Hide |
Range on Protein: 466-484 Range on HMM: 1-19/140 Sequence Identity: 31% (6 aa) RVVLVGPESVGKTSLVARL .||..| . .||.|..... KVVVCGDKGCGKSSFIHQY |
|||||||||
| Ras | AqueK485.AA | Ras | 466-483 | 44 | 0.003688 | 12.33 | Pfam | 1-18 (167) | Show / Hide |
Range on Protein: 466-483 Range on HMM: 1-18/167 Sequence Identity: 44% (8 aa) RVVLVGPESVGKTSLVAR .||.| .|||..|. | KLVLIGDGGVGKSCLLIR |
|||||||||
| Miro | AqueK485.AA | Miro | 553-580 | 25 | 0.916668 | 4.94 | Pfam | 113-140 (140) | Show / Hide |
Range on Protein: 553-580 Range on HMM: 113-140/140 Sequence Identity: 25% (7 aa) SEIISWLSDIQSFSEERVPVLLVFTHLD |....||. ... . .|| .| ...| SNYMAWLPHFRKWGKKAIPVIVVGNKCD |
|||||||||