Gene CAMKL-S1_a (S.moellendorffii)
CAMKL-S1_a
Species: S.moellendorffii
Alias: CAMKL-S1_a
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CAMKL-S1_a.AA | Protein | None | 621 | None | Fasta, JSON |
| CAMKL-S1_a.NA | RNA | None | 1866 | None | Fasta, JSON |
| CAMKL-S1_a.kin_dom | Protein Kinase Domain | None | 18 | None | Fasta, JSON |
Protein domains of CAMKL-S1_a.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | CAMKL-S1_a.AA | AGC | 480-497 | 55 | 1.6e-08 | 16.61 | In-house | 169-188 (395) | Show / Hide |
Range on Protein: 480-497 Range on HMM: 169-188/395 Sequence Identity: 55% (11 aa) LHS-RGVLHRD-IKPSNMLI ||| .|. ||| .|| |.|. LHSHMGIIHRDYLKPENILL |
|||||||||
| Kinase | CAMKL-S1_a.AA | LKB | 480-500 | 61 | 1.8e-08 | 21.33 | In-house | 120-140 (265) | Show / Hide |
Range on Protein: 480-500 Range on HMM: 120-140/265 Sequence Identity: 61% (13 aa) LHSRGVLHRDIKPSNMLIFHD |||..|.|.||||.|.|. || LHSQRVVHKDIKPGNLLLTHD |
|||||||||
| Kinase | CAMKL-S1_a.AA | Trio | 480-500 | 52 | 2.5e-08 | 16.78 | In-house | 111-131 (258) | Show / Hide |
Range on Protein: 480-500 Range on HMM: 111-131/258 Sequence Identity: 52% (11 aa) LHSRGVLHRDIKPSNMLIFHD ||. ..|| ||||.||.. |. LHNCHILHLDIKPENMMMWHY |
|||||||||
| Kinase | CAMKL-S1_a.AA | DCAMKL | 475-501 | 48 | 3.6e-08 | 20.94 | In-house | 126-152 (279) | Show / Hide |
Range on Protein: 475-501 Range on HMM: 126-152/279 Sequence Identity: 48% (13 aa) AALVGLHSRGVLHRDIKPSNMLIFHDE .||. ||.... |||||| | |. .| KALKYLHEMNIVHRDIKPENLLVCKHE |
|||||||||
| Kinase | CAMKL-S1_a.AA | ELM | 480-501 | 59 | 4e-08 | 23.82 | In-house | 163-184 (346) | Show / Hide |
Range on Protein: 480-501 Range on HMM: 163-184/346 Sequence Identity: 59% (13 aa) LHSRGVLHRDIKPSNMLIFHDE ||. |. ||||||||.|| .. LHYQGCIHRDIKPSNLLISENG |
|||||||||
| Kinase | CAMKL-S1_a.AA | CDK | 480-497 | 55 | 4.7e-08 | 21.69 | In-house | 124-141 (284) | Show / Hide |
Range on Protein: 480-497 Range on HMM: 124-141/284 Sequence Identity: 55% (10 aa) LHSRGVLHRDIKPSNMLI .||....|||.||.| || CHSNWIMHRDLKPQNILI |
|||||||||
| Kinase | CAMKL-S1_a.AA | CDC2 | 480-497 | 55 | 5.6e-08 | 20.06 | In-house | 119-136 (301) | Show / Hide |
Range on Protein: 480-497 Range on HMM: 119-136/301 Sequence Identity: 55% (10 aa) LHSRGVLHRDIKPSNMLI .|.|...|||.||.| || CHQRRIMHRDLKPQNILI |
|||||||||
| Kinase | CAMKL-S1_a.AA | CK1-Unclassified | 480-497 | 55 | 1.3e-07 | 18.54 | In-house | 120-137 (244) | Show / Hide |
Range on Protein: 480-497 Range on HMM: 120-137/244 Sequence Identity: 55% (10 aa) LHSRGVLHRDIKPSNMLI ||... .|||||| | |. LHNKNFIHRDIKPDNFLM |
|||||||||
| Kinase | CAMKL-S1_a.AA | CDK-DD1 | 480-497 | 61 | 1.9e-07 | 18.41 | In-house | 114-131 (379) | Show / Hide |
Range on Protein: 480-497 Range on HMM: 114-131/379 Sequence Identity: 61% (11 aa) LHSRGVLHRDIKPSNMLI .|. |. ||||||.| || CHNQGIMHRDIKPANLLI |
|||||||||
| Kinase | CAMKL-S1_a.AA | Ciliate-E2b | 480-500 | 42 | 2e-07 | 18.78 | In-house | 118-138 (272) | Show / Hide |
Range on Protein: 480-500 Range on HMM: 118-138/272 Sequence Identity: 42% (9 aa) LHSRGVLHRDIKPSNMLIFHD ||......|||||.|... |. LHNQNIIYRDIKPENIMVDHK |
|||||||||
| S_TKc | CAMKL-S1_a.AA | S_TKc | 377-603 | 15 | 2e-06 | -83.46 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 377-603
Range on HMM: 1-231/231
Sequence Identity: 15% (40 aa)
LSTASIVGQGYKSVVF----KLPGEDCVIKVSDRSRIGRETFIHERVDGTSFTRPQRKGLRWCGQVLGAGD------GLEWMVL---AGFGRPVTSDN--
..|.| ..|. | |. . ||. . .| || |... . . . ... . .| . | . .
YEILRKIGKGAFGKVYKCRHKKTGRIVAIKIIK-EHIRREIQILKK------------HHPNIVKLYDVFQDDHLYMVMEYCDGDLGDLFDYIKKRGRHG
-----VLWDFQGCWNQASAALVGLHSRGVLHRDIKPSNMLIFHDELWLNDFDCSCLVDESVEIRRMRVGAPYFESP-LFDGAEGFLY-RDDWYSLVLTFL
. . | || .||.|..|||.||.| |. . .. . || .... . .| |.. .| .. |. . . ||.|. ..
LRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE-HIKICDFGLARQL-------TTFCGTPWYMAPEVL----GYGKCKCDWWSCGCILY
DLLG----WYGGGADKNSTLSAAVRNETFPASFKACINWLLA-DGD-----GLFR-------VELM
.| .. .. . .. . ..| |. .| | . ... . .
EMLCGYPPFP--------QMQMMFKKIG-SPEAKDFIRKCLQKDPEKRPTAEALQDEWDIKCHPWF
|
|||||||||
| Kinase | CAMKL-S1_a.AA | Pkinase | 480-532 | 27 | 2.4e-05 | 19.96 | Pfam | 124-180 (293) | Show / Hide |
Range on Protein: 480-532 Range on HMM: 124-180/293 Sequence Identity: 27% (16 aa) LHSRGVLHRDIKPSNMLIF-HDEL----WLNDFDCSCLV-DESVEIRRMRVGAPYFESP .||.|..|||.||.| || .... . || ..... . . ..| |.. .| CHSMGIIHRDLKPENILIDNNGHIDACVKICDFGLAKQFDY-NNS-MTTFCGTPWYMAP |
|||||||||