Gene CDK-Un_c (S.moellendorffii)
CDK-Un_c
Species: S.moellendorffii
Alias: CDK-Un_c
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| CDK-Un_c.AA | Protein | None | 602 | None | Fasta, JSON |
| CDK-Un_c.NA | RNA | None | 1809 | None | Fasta, JSON |
| CDK-Un_c.kin_dom | Protein Kinase Domain | None | 197 | None | Fasta, JSON |
Protein domains of CDK-Un_c.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| S_TKc | CDK-Un_c.AA | S_TKc | 148-487 | 14 | 1.1e-13 | 24.05 | SMART | 1-231 (231) | Show / Hide |
Range on Protein: 148-487
Range on HMM: 1-231/231
Sequence Identity: 14% (52 aa)
FVLEKKIGEGAFGSVYKGSFANPQKKVLGFLVVKKASEYGEVEAWMNQRVRRACPGKCADYLDGFKMRVNPKRKEFWLVWRYEGVATLADFMSSKDFPYN
. . .|||.||||.|||. . .|. .
YEILRKIGKGAFGKVYKCRHKK----TGRIVAIKIIK------------------------------------------------------------EHI
VSEFSVHARMDLLKISNRDRQVE-----------KA--LSLKTTLLAKGAE-----RENQIIQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESKSF
.| ... . . | . . .|.. . .| . .......... | .|. ||.|||.||.|| ...
RREIQILKK-HHPNIVKLYDVFQDDHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFPFPE-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE---HI
KIIDLGAATDLRVGINYIPQEFLLDPRYAAPEQYIMSTQTPSAPSPVIATALSPVLWQLNLPD-RFDIYSLGLMFLQMVF-SNLRSDSALIQFNRQLKRM
||.| | |. | | | | ||| . |..|.| .. |. . . | .. .|..
KICDFGLARQL--------TTFCGTPWYMAPEVL-------------------------GYGKCKCDWWSCGCILYEMLCGYPPFP-----QMQMMFKKI
DHDLVAWRDLVDARPNADVQRGFEILDMDGGAGWELLQAMMQFKGRQRISAKAALG-------HPYF
...... ..|. ..|..| || ||.|
G----------------------------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2-Unclassified | 287-411 | 23 | 3.1e-13 | 42.28 | In-house | 136-268 (352) | Show / Hide |
Range on Protein: 287-411 Range on HMM: 136-268/352 Sequence Identity: 23% (36 aa) ENQIIQ-----SLLQELLKCLRGLHDTG-IVHRDIKPQNIIFSDESK--SFKIIDLGAATDLRVGINY-----------IPQEF---LLDPRYA----AP . | .. .. ..|..| || . |.||||||.||.|... | ||||.| . . .|. ..|.. |.| || TEQQAKYKKAKFYFAQILQGLEYLHHKNNIIHRDIKPENILFDNNGKNYYIKIIDFGISKKYQQNNNCDTNQQQKMQIWKQQMMWTFCGTPNYMPQYTAP EQYIM-STQTPSAPSPVIATALSPVLWQLNLPDRFDIYSLGLMFLQMVFSNL | . ...| ||.||| . .|.| .. EVLQGQNYDHSKA-------------------YKCDIWSLGVILYEMLFGYY |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2a | 291-347 | 36 | 3.1e-13 | 35.34 | In-house | 103-167 (275) | Show / Hide |
Range on Protein: 291-347 Range on HMM: 103-167/275 Sequence Identity: 36% (24 aa) IQSLLQELL-KCLRGLHDTGIVHRDIKPQNIIFS---DES---KSFKIIDLGAATDLRVGIN-YI | ...| || . | .| .|.|||.||.||.| .| . |||| | ||. .. |. ICDIMQQLLWQGLHYMHQRNIMHRDLKPENILFKNCSKNSIQNSDIKIIDFGLATFIDKDEKKYM |
|||||||||
| Kinase | CDK-Un_c.AA | CK2 | 291-337 | 44 | 1.3e-12 | 33.19 | In-house | 97-143 (288) | Show / Hide |
Range on Protein: 291-337 Range on HMM: 97-143/288 Sequence Identity: 44% (21 aa) IQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESKSFKIIDLGAA |. . |||| | | ||.|||.||.||. | . ..|| | | IRYYMFELLKALDYCHSMGIMHRDVKPHNIMIDHEKRKLRLIDWGLA |
|||||||||
| Kinase | CDK-Un_c.AA | CMGC | 289-335 | 21 | 2.3e-12 | 36.02 | In-house | 174-249 (513) | Show / Hide |
Range on Protein: 289-335 Range on HMM: 174-249/513 Sequence Identity: 21% (16 aa) QIIQSLL------QELLKCLR--GLHDTG--IVHRDIKPQNIIFSDESKSF-------------------KIIDLG . |.... . .|..| .| . |.|||.||.|| .... ... ||.| | HNIKYFMIHIRYMYQILRGLKLKYCHSHWGNIIHRDLKPENILINHNCELITRMMWKSEDWNPCQKNGRLKICDFG |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2 | 289-340 | 29 | 3.5e-12 | 38.09 | In-house | 145-206 (365) | Show / Hide |
Range on Protein: 289-340 Range on HMM: 145-206/365 Sequence Identity: 29% (20 aa) QIIQSLLQELLK---------------CLRGLHDTG-IVHRDIKPQNIIFSDESKSFKIIDLGAATDL . |. . ...|. .|. || . |.||||||.||.| ||||.| .... KEIKYIMKQILQGFKTKAEFYIACIILALEYLHSKNNIIHRDIKPENILF------IKIIDFGLSKKY |
|||||||||
| Kinase | CDK-Un_c.AA | CDK5 | 458-487 | 63 | 1.8e-11 | 32.04 | In-house | 258-287 (287) | Show / Hide |
Range on Protein: 458-487 Range on HMM: 258-287/287 Sequence Identity: 63% (19 aa) GAGWELLQAMMQFKGRQRISAKAALGHPYF . | .||| |.|.. ||||||||| |||| EKGMDLLQKMLQCNPNQRISAKAALHHPYF |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 289-340 | 30 | 2.4e-10 | 32.42 | In-house | 130-192 (329) | Show / Hide |
Range on Protein: 289-340 Range on HMM: 130-192/329 Sequence Identity: 30% (19 aa) QIIQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESKS-----------FKIIDLGAATDL |.... .. .| .. ||. .|.||||||||| .. . .|| | | | . QEAIQFFKQILNGFKELHKHNIIHRDIKPQNILIHNGQPKTDSKKVHPNGVLKIADFGFAKHV |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 289-340 | 28 | 2.5e-10 | 32.89 | In-house | 126-188 (324) | Show / Hide |
Range on Protein: 289-340 Range on HMM: 126-188/324 Sequence Identity: 28% (18 aa) QIIQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESKS-----------FKIIDLGAATDL |.... .. .. .. ||. .|.||||||||| .. . .|| | | | . QEAIQFFKQICNGFKELHKHNIIHRDIKPQNILIHNGQPKTDSKKVHPNGVLKIADFGFAKHV |
|||||||||
| Kinase | CDK-Un_c.AA | CDC2 | 460-487 | 57 | 4.3e-10 | 26.66 | In-house | 274-301 (301) | Show / Hide |
Range on Protein: 460-487 Range on HMM: 274-301/301 Sequence Identity: 57% (16 aa) GWELLQAMMQFKGRQRISAKAALGHPYF | .||. | | .|||||.|| |||| GIDLLMQMLQYDPQKRISAKEALQHPYF |
|||||||||
| Kinase | CDK-Un_c.AA | Pkinase | 305-408 | 24 | 7e-10 | 36.02 | Pfam | 124-207 (293) | Show / Hide |
Range on Protein: 305-408 Range on HMM: 124-207/293 Sequence Identity: 24% (26 aa) LHDTGIVHRDIKPQNIIFSDESKSF----KIIDLGAATDLRVGINYIPQEFLLDPRYAAPEQYIMSTQTPSAPSPVIATALSPVLWQLNLPDRFDIYSLG .|. ||.|||.||.|| .. . ||.| | | .. | .. | |.|.||| . . . |..|.| CHSMGIIHRDLKPENILID-NNGHIDACVKICDFGLAKQFDY-NNS-MTTFCGTPWYMAPEVIR---------------------GGQYYGPKVDMWSCG LMFLQMVF ... .|.. CILYEMLC |
|||||||||
| Kinase | CDK-Un_c.AA | CDK | 462-487 | 50 | 1.1e-09 | 26.94 | In-house | 259-284 (284) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 259-284/284 Sequence Identity: 50% (13 aa) ELLQAMMQFKGRQRISAKAALGHPYF .||. |... .||||..|| |||| DLLNKMLCYDPKKRISAEQALQHPYF |
|||||||||
| Kinase | CDK-Un_c.AA | CMGC | 462-487 | 50 | 6.6e-09 | 24.43 | In-house | 488-513 (513) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 488-513/513 Sequence Identity: 50% (13 aa) ELLQAMMQFKGRQRISAKAALGHPYF .||. |.|. .||.|. || |||| DLLKKMLQYDPDKRITAEQALQHPYF |
|||||||||
| Kinase | CDK-Un_c.AA | CDK | 291-335 | 36 | 9.5e-09 | 23.94 | In-house | 110-158 (284) | Show / Hide |
Range on Protein: 291-335 Range on HMM: 110-158/284 Sequence Identity: 36% (18 aa) IQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESK----SFKIIDLG |..... ||. | .|. .|.|||.||||| .. . . || | | IKCYMWQLLRGLHYCHSNWIMHRDLKPQNILINNNGEVKCGRLKIADFG |
|||||||||
| Kinase | CDK-Un_c.AA | CDC2 | 289-335 | 36 | 1.6e-08 | 21.73 | In-house | 103-148 (301) | Show / Hide |
Range on Protein: 289-335 Range on HMM: 103-148/301 Sequence Identity: 36% (17 aa) QIIQSLLQELLKCLRGLHDTGIVHRDIKPQNIIFSDESKSFKIIDLG |...|.. .|. . .| .|.|||.||||| ... . || | | QLVKSYMYQILQGVHFCHQRRIMHRDLKPQNILIDKKGN-IKIADFG |
|||||||||
| Kinase | CDK-Un_c.AA | CK2 | 463-487 | 44 | 2.9e-08 | 19.96 | In-house | 264-288 (288) | Show / Hide |
Range on Protein: 463-487 Range on HMM: 264-288/288 Sequence Identity: 44% (11 aa) LLQAMMQFKGRQRISAKAALGHPYF .| |... .||.|| |..|||| FLDKMLRYDHQERITAKEAMEHPYF |
|||||||||
| Kinase | CDK-Un_c.AA | CDK5 | 287-319 | 45 | 8.3e-07 | 17.02 | In-house | 96-128 (287) | Show / Hide |
Range on Protein: 287-319 Range on HMM: 96-128/287 Sequence Identity: 45% (15 aa) ENQIIQSLLQELLKCLRGLHDTGIVHRDIKPQN . .||.|.. ||| | |. . ||| |||| DMHIIKSFMYQLLKGLAFCHEHHVLHRDLKPQN |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 148-165 | 50 | 1e-06 | 19.21 | In-house | 1-18 (329) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/329 Sequence Identity: 50% (9 aa) FVLEKKIGEGAFGSVYKG ..| ...|.|.|| |||| YCLNHCLGKGSFGKVYKG |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 148-165 | 47 | 2e-06 | 19.3 | In-house | 1-19 (324) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-19/324 Sequence Identity: 47% (9 aa) FVLEKKIGEGAFG-SVYKG ..| ...|.|.|| |||| YCLNHCLGKGSFGVKVYKG |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2a | 148-164 | 58 | 2e-06 | 14.95 | In-house | 1-17 (275) | Show / Hide |
Range on Protein: 148-164 Range on HMM: 1-17/275 Sequence Identity: 58% (10 aa) FVLEKKIGEGAFGSVYK . ..||||.|.|||||. YKFIKKIGKGNFGSVYL |
|||||||||
| Kinase | CDK-Un_c.AA | CDK | 148-165 | 50 | 3e-06 | 15.93 | In-house | 1-18 (284) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/284 Sequence Identity: 50% (9 aa) FVLEKKIGEGAFGSVYKG . .|||||..| |||. YEKLEKIGEGTYGVVYKA |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2 | 148-166 | 57 | 9e-06 | 15.79 | In-house | 1-19 (365) | Show / Hide |
Range on Protein: 148-166 Range on HMM: 1-19/365 Sequence Identity: 57% (11 aa) FVLEKKIGEGAFGSVYKGS . . ||||.|.||||||.. YKFIKKIGQGNFGSVYKCK |
|||||||||
| Kinase | CDK-Un_c.AA | CMGC | 148-165 | 55 | 1e-05 | 13.8 | In-house | 1-18 (513) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/513 Sequence Identity: 55% (10 aa) FVLEKKIGEGAFGSVYKG . ||||||..| |||. YEIIKKIGEGTYGVVYKC |
|||||||||
| Pkinase_Tyr | CDK-Un_c.AA | Pkinase_Tyr | 148-165 | 66 | 1.2e-05 | 19.72 | Pfam | 1-18 (270) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/270 Sequence Identity: 66% (12 aa) FVLEKKIGEGAFGSVYKG .. ||.||||||.|||| ITFGKKLGEGAFGEVYKG |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2-Unclassified | 148-164 | 52 | 3.2e-05 | 14.08 | In-house | 1-17 (352) | Show / Hide |
Range on Protein: 148-164 Range on HMM: 1-17/352 Sequence Identity: 52% (9 aa) FVLEKKIGEGAFGSVYK . . |.||.|.||.||| YKIIKQIGQGGFGKVYK |
|||||||||
| Kinase | CDK-Un_c.AA | CDC2 | 148-165 | 50 | 6.7e-05 | 10.43 | In-house | 1-18 (301) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/301 Sequence Identity: 50% (9 aa) FVLEKKIGEGAFGSVYKG . .||||| .| |||. YQKIEKIGEGTYGVVYKC |
|||||||||
| Kinase | CDK-Un_c.AA | Pkinase | 148-165 | 50 | 7.6e-05 | 18.22 | Pfam | 1-18 (293) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/293 Sequence Identity: 50% (9 aa) FVLEKKIGEGAFGSVYKG .....|||.|.||.|||. YHIGRKIGSGSFGCVYKC |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2a | 474-487 | 57 | 0.000176 | 9.13 | In-house | 262-275 (275) | Show / Hide |
Range on Protein: 474-487 Range on HMM: 262-275/275 Sequence Identity: 57% (8 aa) QRISAKAALGHPYF .||.|. || ||.| KRITAQQALNHPWF |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2 | 463-487 | 30 | 0.000404 | 10.02 | In-house | 336-365 (365) | Show / Hide |
Range on Protein: 463-487 Range on HMM: 336-365/365 Sequence Identity: 30% (9 aa) LLQA----MMQFKGRQRIS-AKAALGHPYF |.. |.| . .||. .. .| ||.| LIKKFGKRMLQKDPEKRITGWEQILNHPWF |
|||||||||
| Kinase | CDK-Un_c.AA | Ciliate-E2-Unclassified | 462-487 | 38 | 0.00566 | 6.18 | In-house | 327-352 (352) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 327-352/352 Sequence Identity: 38% (10 aa) ELLQAMMQFKGRQRISAKAALGHPYF .||| |.. . .||... .| ||.| DLLQKMLKKNPNKRITFEQILNHPWF |
|||||||||
| Kinase | CDK-Un_c.AA | Pkinase | 462-487 | 23 | 0.006863 | 11.3 | Pfam | 268-293 (293) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 268-293/293 Sequence Identity: 23% (6 aa) ELLQAMMQFKGRQRISAKAALGHPYF ... . ... .|..|. .| ||.| DFIKWCLCKDPKKRPTAEQILQHPWF |
|||||||||
| Kinase | CDK-Un_c.AA | CDK5 | 148-165 | 50 | 0.011606 | 3.69 | In-house | 1-18 (287) | Show / Hide |
Range on Protein: 148-165 Range on HMM: 1-18/287 Sequence Identity: 50% (9 aa) FVLEKKIGEGAFGSVYKG . ||||| .| |||. YEKMEKIGEGTYGTVYKA |
|||||||||
| Kinase | CDK-Un_c.AA | CK2 | 148-181 | 26 | 0.012053 | 2.87 | In-house | 1-32 (288) | Show / Hide |
Range on Protein: 148-181 Range on HMM: 1-32/288 Sequence Identity: 26% (9 aa) FVLEKKIGEGAFGSVYKGSFANPQKKVLGFLVVK . ...||| | . |..| . ..|. .|.| YEVIRKIGRGKYSEVFEGINIKNNEKC--KIVIK |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 462-487 | 34 | 0.143819 | 1.35 | In-house | 304-329 (329) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 304-329/329 Sequence Identity: 34% (9 aa) ELLQAMMQFKGRQRISAKAALGHPYF .|.. |.|.. ..||| . || | DLIRRMLQYDEKDRISWEELFNHPWF |
|||||||||
| Kinase | CDK-Un_c.AA | ULK | 462-487 | 34 | 0.278008 | 0.38 | In-house | 299-324 (324) | Show / Hide |
Range on Protein: 462-487 Range on HMM: 299-324/324 Sequence Identity: 34% (9 aa) ELLQAMMQFKGRQRISAKAALGHPYF .|.. |.|.. ..||| . || | DLIRRMLQYDEKDRISWEEIFNHPWF |
|||||||||