Gene IRAK-0_l (S.moellendorffii)
IRAK-0_l
Species: S.moellendorffii
Alias: IRAK-0_l
External Links:
Annotation:
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| IRAK-0_l.AA | Protein | None | 281 | None | Fasta, JSON |
| IRAK-0_l.NA | RNA | None | 846 | None | Fasta, JSON |
| IRAK-0_l.kin_dom | Protein Kinase Domain | None | 33 | None | Fasta, JSON |
Protein domains of IRAK-0_l.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Malectin | IRAK-0_l.AA | Malectin | 1-90 | 37 | 3.7e-12 | 49.03 | Pfam | 100-202 (202) | Show / Hide |
Range on Protein: 1-90 Range on HMM: 100-202/202 Sequence Identity: 37% (39 aa) MRSGSYTVHLHFAEIIIDT---GQDGPG-----VGIQGDRKLKDFNIREEANGSLRALRRSFTVVNVSNGVRD--IHLLGWGKEHVALHSD--LSG-PLI ...|.||| ||||||.. . . ..|| | ||| . ||||.|..||.|. .| ..| |.|.||. . ||. || ... | |.| LENGNYTVILHFAEIYFQDTDQTWNSPGRRVFDVYIQGKLVLKDFDIWKEAGGKGKAAHKEFINVTVTNGTLEYVIHFYWAGKGTCCIPFRKGYYGNPKI STI | | SAI |
|||||||||
| Kinase | IRAK-0_l.AA | AGC | 152-183 | 33 | 4.1e-11 | 23.48 | In-house | 1-39 (395) | Show / Hide |
Range on Protein: 152-183 Range on HMM: 1-39/395 Sequence Identity: 33% (13 aa) FDPLRLLGTGAFGKVYKGVL-------SDGTVVAIKQLN |. |...|.|.||||| . | . |.| |. FEFLKVIGKGSFGKVYLVRKKDGCHKKDTGKYYAMKVLK |
|||||||||
| Kinase | IRAK-0_l.AA | Ciliate-A9 | 152-180 | 34 | 7.8e-10 | 18.71 | In-house | 1-32 (392) | Show / Hide |
Range on Protein: 152-180 Range on HMM: 1-32/392 Sequence Identity: 34% (11 aa) FDPLRLLGTGAFGKVYKGV-LS--DGTVVAIK | | .| ||||.|... .. |....|.| FEPIKIIGEGAFGCVIQCRDIQQEDKQEYAVK |
|||||||||
| Kinase | IRAK-0_l.AA | LISK | 157-184 | 51 | 1.5e-09 | 26.98 | In-house | 1-29 (296) | Show / Hide |
Range on Protein: 157-184 Range on HMM: 1-29/296 Sequence Identity: 51% (15 aa) LLGTGAFGKVYKGVLS-DGTVVAIKQLNR .| |.||||||| . .|.|.|||.. | EIGKGFFGKVYKGTHRQTGQVMAIKMIHR |
|||||||||
| Kinase | IRAK-0_l.AA | MST | 152-183 | 42 | 1.1e-08 | 23.62 | In-house | 1-33 (254) | Show / Hide |
Range on Protein: 152-183 Range on HMM: 1-33/254 Sequence Identity: 42% (14 aa) FDPLRLLGTGAFGKVYKGV-LSDGTVVAIKQLN || . .|| |..|.||| . ...| .||||... FDIVEKLGQGSYGSVYKAIHKQTGKIVAIKMVP |
|||||||||
| Kinase | IRAK-0_l.AA | TKL | 158-184 | 33 | 1.2e-08 | 27.25 | In-house | 1-36 (364) | Show / Hide |
Range on Protein: 158-184 Range on HMM: 1-36/364 Sequence Identity: 33% (12 aa) LGTGAFGKVYKGVLSD---------GTVVAIKQLNR .| |.||.||||.. |..||.|.... IGSGGFGEVYKGKWRGWGGKCPSDTGKDVAVKKFKS |
|||||||||
| Kinase | IRAK-0_l.AA | RAD53 | 152-183 | 30 | 7.2e-08 | 18.98 | In-house | 1-33 (305) | Show / Hide |
Range on Protein: 152-183 Range on HMM: 1-33/305 Sequence Identity: 30% (10 aa) FDPLRLLGTGAFGKVYKGVL-SDGTVVAIKQLN .. . ||.|.||.|.... ... .||||... YYMSKELGSGNFGTVKLAYEKKTCQKVAIKIID |
|||||||||
| Kinase | IRAK-0_l.AA | STE | 152-183 | 29 | 8.2e-08 | 23.79 | In-house | 1-48 (359) | Show / Hide |
Range on Protein: 152-183 Range on HMM: 1-48/359 Sequence Identity: 29% (14 aa) FDPLRLLGTGAFGKVYKGVLSD----------------GTVVAIKQLN .. .. .| ||||.|||.. . |...||||.| WEGIEKIGKGAFGTVYKAMNHKNCNIHKTGEVENNGETGEIMAIKQMN |
|||||||||
| Kinase | IRAK-0_l.AA | IRAK | 152-182 | 37 | 1.4e-07 | 23.11 | In-house | 1-32 (317) | Show / Hide |
Range on Protein: 152-182 Range on HMM: 1-32/317 Sequence Identity: 37% (12 aa) FDPLRLLGTGAFGKVYKGVLSDGT-VVAIKQL |.. ...| |.|| ||.|... | ..|.| | FHKDNRIGEGGFGCVYRGQWKNTTGIYAVKKL |
|||||||||
| Kinase | IRAK-0_l.AA | TK | 152-182 | 23 | 2.5e-07 | 19.79 | In-house | 1-60 (486) | Show / Hide |
Range on Protein: 152-182 Range on HMM: 1-60/486 Sequence Identity: 23% (14 aa) FDPLRLLGTGAFG---KVYKGVLSDG--------------------------TVVAIKQL .. || |.|| .|||| . .. | ||.|.| ITLGKKLGEGQFGSFGEVYKGEWRGRNPWNGKRFPCHMTVTLKCKNGKEGGKTPVAVKML |
|||||||||
| Pkinase_Tyr | IRAK-0_l.AA | Pkinase_Tyr | 152-188 | 33 | 7.3e-07 | 23.87 | Pfam | 1-42 (270) | Show / Hide |
Range on Protein: 152-188 Range on HMM: 1-42/270 Sequence Identity: 33% (14 aa) FDPLRLLGTGAFGKVYKGVLS-----DGTVVAIKQLNRITGD .. || ||||.||||.. ... ||.| |. . . ITFGKKLGEGAFGEVYKGTWKGDPDNTKIPVAVKMLKEGAMH |
|||||||||
| Kinase | IRAK-0_l.AA | TK-Unique | 152-184 | 27 | 5e-06 | 16.88 | In-house | 1-40 (294) | Show / Hide |
Range on Protein: 152-184 Range on HMM: 1-40/294 Sequence Identity: 27% (11 aa) FDPLRLLGTGAFGKVYKGVLSDGT-------VVAIKQLNR . ....|.|||| |..| .. .. .||.|.|.. LEVGDVIGEGAFGQVWRGEVWGIWKHWDKQKCVAVKMLKD |
|||||||||
| Kinase | IRAK-0_l.AA | Pkinase | 152-184 | 32 | 7e-06 | 21.9 | Pfam | 1-34 (293) | Show / Hide |
Range on Protein: 152-184 Range on HMM: 1-34/293 Sequence Identity: 32% (11 aa) FDPLRLLGTGAFGKVYKGVLSDGTV-VAIKQLNR . .| .| |.||.|||.. . ||.|.... YHIGRKIGSGSFGCVYKCHHKGTGKIVAVKIIKK |
|||||||||
| Kinase | IRAK-0_l.AA | IRAK | 195-210 | 56 | 0.000697 | 9.84 | In-house | 206-221 (317) | Show / Hide |
Range on Protein: 195-210 Range on HMM: 206-221/317 Sequence Identity: 56% (9 aa) DVYSFGVLVLEIVSGR ||||||. .||...|. DVYSFGIVLLEVLTGC |
|||||||||
| Kinase | IRAK-0_l.AA | LISK | 194-211 | 38 | 0.00102 | 7.73 | In-house | 220-237 (296) | Show / Hide |
Range on Protein: 194-211 Range on HMM: 220-237/296 Sequence Identity: 38% (7 aa) ADVYSFGVLVLEIVSGRT .||.|||....||. ... CDVFSFGIVLCEIITRVK |
|||||||||
| Kinase | IRAK-0_l.AA | TKL | 194-211 | 44 | 0.002077 | 8.15 | In-house | 270-287 (364) | Show / Hide |
Range on Protein: 194-211 Range on HMM: 270-287/364 Sequence Identity: 44% (8 aa) ADVYSFGVLVLEIVSGRT .||||||.. ||..... CDVYSFGIVLWEILTRCR |
|||||||||
| Kinase | IRAK-0_l.AA | TK-Unique | 195-208 | 64 | 0.003424 | 7.0 | In-house | 221-234 (294) | Show / Hide |
Range on Protein: 195-208 Range on HMM: 221-234/294 Sequence Identity: 64% (9 aa) DVYSFGVLVLEIVS ||.||||| ||.. DVWSFGVLMWEIFT |
|||||||||
| Kinase | IRAK-0_l.AA | TK | 195-208 | 64 | 0.01419 | 3.59 | In-house | 376-389 (486) | Show / Hide |
Range on Protein: 195-208 Range on HMM: 376-389/486 Sequence Identity: 64% (9 aa) DVYSFGVLVLEIVS ||.|||||. ||.. DVWSFGVLMWEIFT |
|||||||||
| Kinase | IRAK-0_l.AA | Pkinase_Tyr | 195-211 | 55 | 0.989027 | 3.1 | Pfam | 196-213 (270) | Show / Hide |
Range on Protein: 195-211 Range on HMM: 196-213/270 Sequence Identity: 55% (10 aa) DVYSFGVLVLEIVS-GRT ||.||||| ||.. |.. DVWSFGVLMWEIFTYGEQ |
|||||||||
| Pkinase | IRAK-0_l.AA | Pkinase | 193-211 | 31 | 1.184657 | 3.39 | Pfam | 192-210 (293) | Show / Hide |
Range on Protein: 193-211 Range on HMM: 192-210/293 Sequence Identity: 31% (6 aa) PADVYSFGVLVLEIVSGRT ..|..|.|... | ..||. KVDMWSCGCILYEMLCGRP |
|||||||||