Gene GL50803_3490 (G.lamblia)
Sequence
| Name | Sequence Type | Origin | Length | Description | Download |
|---|---|---|---|---|---|
| GL50803_3490.AA | Protein | None | 744 | None | Fasta, JSON |
| GL50803_3490.kin_dom | Protein Kinase Domain | None | 263 | None | Fasta, JSON |
Protein domains of GL50803_3490.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | GL50803_3490.AA | NEK | 231-269 | 31 | 9.7e-08 | 23.76 | In-house | 246-286 (286) | Show / Hide |
Range on Protein: 231-269 Range on HMM: 246-286/286 Sequence Identity: 31% (13 aa) FPEISLK--YSNELYNVVQLMATSEEEHRPSATNLLKNHLI .| |. . ||..| |....| . . |.|||.. .|.. .| YPPIPSHRMYSQDLQNLISQMLQKDPEQRPSCNQILEMPFI |
|||||||||
| Kinase | GL50803_3490.AA | WEE | 230-269 | 32 | 1.7e-07 | 21.27 | In-house | 258-297 (297) | Show / Hide |
Range on Protein: 230-269 Range on HMM: 258-297/297 Sequence Identity: 32% (13 aa) PFPEISLKYSNELYNVVQLMATSEEEHRPSATNLLKNHLI ||||.. ..| || .....| | ||.. ||..... PFPEFDNIISQELKQLIKWMMHPDPEQRPTCQQLLQHPVL |
|||||||||
| Kinase | GL50803_3490.AA | WEE | 92-128 | 35 | 2e-06 | 17.45 | In-house | 91-129 (297) | Show / Hide |
Range on Protein: 92-128 Range on HMM: 91-129/297 Sequence Identity: 35% (14 aa) S--LQDVIDDRIFHQEPFSEEEIWDILVQCLAGLSYIHN | ||. | . . . ..|..||.|||. . ||..||. SNLLQFWIQQCHNWNHWLPEWMIWQILVDICQGLHHIHS |
|||||||||
| Kinase | GL50803_3490.AA | NEK1 | 230-269 | 35 | 2e-06 | 18.34 | In-house | 237-276 (276) | Show / Hide |
Range on Protein: 230-269 Range on HMM: 237-276/276 Sequence Identity: 35% (14 aa) PFPEISLKYSNELYNVVQLMATSEEEHRPSATNLLKNHLI ..| |. ||.|| . | | .||||.. .|. . | TYPPIPPHYSYELQSLVSQMFKRNPRHRPSVNQILERPFI |
|||||||||
| Kinase | GL50803_3490.AA | NEK | 105-128 | 41 | 6e-06 | 17.27 | In-house | 109-132 (286) | Show / Hide |
Range on Protein: 105-128 Range on HMM: 109-132/286 Sequence Identity: 41% (10 aa) EPFSEEEIWDILVQCLAGLSYIHN ..|.||.|||...| . .| |.|. KYFEEEQIWDWFIQMCLALKYMHD |
|||||||||
| Kinase | GL50803_3490.AA | NEK2 | 238-269 | 31 | 7.8e-05 | 12.07 | In-house | 288-319 (319) | Show / Hide |
Range on Protein: 238-269 Range on HMM: 288-319/319 Sequence Identity: 31% (10 aa) YSNELYNVVQLMATSEEEHRPSATNLLKNHLI || .| .. .| .|||| .|.. .| YSRHLNEIIHFMINVDHYHRPSIEEILQHPQI |
|||||||||
| Kinase | GL50803_3490.AA | Ciliate-E4 | 106-125 | 40 | 0.000121 | 12.0 | In-house | 103-122 (150) | Show / Hide |
Range on Protein: 106-125 Range on HMM: 103-122/150 Sequence Identity: 40% (8 aa) PFSEEEIWDILVQCLAGLSY .|.| |||.|. .| ...| HFDESEIWQIAFCCINAMYY |
|||||||||
| S_TKc | GL50803_3490.AA | S_TKc | 30-269 | 12 | 0.000172 | -111.06 | SMART | 13-231 (231) | Show / Hide |
Range on Protein: 30-269 Range on HMM: 13-231/231 Sequence Identity: 12% (35 aa) GRVCYCERIS------LKRFKHKYKEKISTYINKISLLNHINLVKYSPYRNNVSNLFYDVYTDMTFGCSLQDVIDD------RIFHQEP-------FSEE |.|. | .. .|. | ..... |.. | |. .|.. .. .. . . .| .. .. . |.| GKVYKCRHKKTGRIVAIKIIK-------------EHIRREIQILKK--HHPNIVKLYDVFQD--DHLYMVMEYCDGDLGDLFDYIKKRGRHGLRFPFPE- EIWDILVQCLAGLSYIHNWKN------------LDGLHSFPHGCLDPKHIYFDSFGVLKIGNLAQSCINAASTSAAQQPQMYDAPEVKLTGTRSH-VSDT ... .. | . .| |.|. . || ..||. ... . | |||| .. .| HARFYMYQICCALEYCHSH-GIIHRDLKPENILLDE--------------------HIKICDFGLARQL----TTFCGTPWYMAPEVL---GYGKCKCDW YSLAKLIHSLATVDHHFCSDPSISTAELRMLYPFPEISLKYSNELYNVVQLMATSEEEHRPSATNLLK-------NHLI .|. .. ... |. . .... | |. . .. . . . |.||.| .|. . WSCGCILYEMLCGYPPFP----QMQMMFKKIG---------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF |
|||||||||
| Kinase | GL50803_3490.AA | NEK10 | 90-127 | 31 | 0.00029 | 9.7 | In-house | 99-136 (279) | Show / Hide |
Range on Protein: 90-127 Range on HMM: 99-136/279 Sequence Identity: 31% (12 aa) GCSLQDVIDDRIFHQEPFSEEEIWDILVQCLAGLSYIH ||.|.. . .. |.|| || ...| . | | | GCPLYEHFNSMKEKHHHFEEERIWHMFIQMCLALRYLH |
|||||||||
| Kinase | GL50803_3490.AA | MEKK15 | 230-269 | 32 | 0.000802 | 9.78 | In-house | 225-264 (264) | Show / Hide |
Range on Protein: 230-269 Range on HMM: 225-264/264 Sequence Identity: 32% (13 aa) PFPEISLKYSNELYNVVQLMATSEEEHRPSATNLLKNHLI | |.. |.| . . |.. | . . ||.| .||| | PMPQLPVKFSEDARMFVRMCLTRDQHERPTASQLLKHPFI |
|||||||||
| Ank | GL50803_3490.AA | Ank | 287-308 | 22 | 2.290337 | 5.58 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 287-308 Range on HMM: 1-22/33 Sequence Identity: 22% (5 aa) NNRTELMNAVLRNDIDTVMNLI . .| |. |....... | |. DGFTPLHLACRCGHTEVVKMLL |
|||||||||
| Ank | GL50803_3490.AA | Ank | 318-341 | 33 | 0.011667 | 13.85 | Pfam | 1-24 (33) | Show / Hide |
Range on Protein: 318-341 Range on HMM: 1-24/33 Sequence Identity: 33% (8 aa) SGKTALIHAAENGYIEIAKCLVRY | |.| |...|..|..|.|. . DGFTPLHLACRCGHTEVVKMLLQH |
|||||||||
| Ank | GL50803_3490.AA | Ank | 354-374 | 38 | 0.000461 | 18.91 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 354-374 Range on HMM: 1-21/33 Sequence Identity: 38% (8 aa) RGMTALMFAARNGNHGIVSLL |.|.|. |.|.|.. .|..| DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_3490.AA | Ank | 447-472 | 26 | 0.001194 | 17.42 | Pfam | 1-26 (33) | Show / Hide |
Range on Protein: 447-472 Range on HMM: 1-26/33 Sequence Identity: 26% (7 aa) RGFTALMVAAANNKNDMLDYLIEREA |||.|..|. .. ... .|... | DGFTPLHLACRCGHTEVVKMLLQHGA |
|||||||||
| Ank | GL50803_3490.AA | Ank | 478-499 | 31 | 0.012123 | 13.79 | Pfam | 1-22 (33) | Show / Hide |
Range on Protein: 478-499 Range on HMM: 1-22/33 Sequence Identity: 31% (7 aa) NDYTALMAAARANNVQAVNMLI . .|.|. |.| .... | ||. DGFTPLHLACRCGHTEVVKMLL |
|||||||||
| Ank | GL50803_3490.AA | Ank | 509-534 | 30 | 0.000286 | 19.66 | Pfam | 1-26 (33) | Show / Hide |
Range on Protein: 509-534 Range on HMM: 1-26/33 Sequence Identity: 30% (8 aa) NGWSALMYAAHGNNTECILALLDKEA .|...|..|.. ..||.. ||.. | DGFTPLHLACRCGHTEVVKMLLQHGA |
|||||||||
| Ank | GL50803_3490.AA | Ank | 540-560 | 38 | 0.097782 | 10.52 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 540-560 Range on HMM: 1-21/33 Sequence Identity: 38% (8 aa) GLQTAMMIAAQCNHLEAVKIL .|. ..|..|.|.| || | DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_3490.AA | Ank | 571-593 | 39 | 0.001031 | 17.65 | Pfam | 1-23 (33) | Show / Hide |
Range on Protein: 571-593 Range on HMM: 1-23/33 Sequence Identity: 39% (9 aa) DGFTAFLYASDRGNYQIVDFLLD ||||. .|. .|....| .||. DGFTPLHLACRCGHTEVVKMLLQ |
|||||||||
| Ank | GL50803_3490.AA | Ank | 602-622 | 47 | 0.001099 | 17.55 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 602-622 Range on HMM: 1-21/33 Sequence Identity: 47% (10 aa) SGYTGLMLAAKKGHAKIVKLL |.| |.||...||...||.| DGFTPLHLACRCGHTEVVKML |
|||||||||
| Ank | GL50803_3490.AA | Ank | 638-661 | 33 | 0.310529 | 8.71 | Pfam | 1-24 (33) | Show / Hide |
Range on Protein: 638-661 Range on HMM: 1-24/33 Sequence Identity: 33% (8 aa) PGTTALMFACFNRQYECAKILCRY | |.|. ||.. ..|..| | . DGFTPLHLACRCGHTEVVKMLLQH |
|||||||||
| Ank | GL50803_3490.AA | Ank | 669-689 | 33 | 0.122265 | 10.17 | Pfam | 1-21 (33) | Show / Hide |
Range on Protein: 669-689 Range on HMM: 1-21/33 Sequence Identity: 33% (7 aa) VGTTALMAAVSSKAPDCVKLL | |.|. |... ...||.| DGFTPLHLACRCGHTEVVKML |
|||||||||