Gene FASTK (Mouse)

FASTK

Species: Mouse
Alias: FASTK, Fastk
External Links: MGI , Entrez Gene , Refseq cDNA , Refseq Protein , Phosphosite , iHOP
Annotation:

Classification

Group: Atypical
Family: FAST

Sequence

Name Sequence Type Origin Length Description Download
FASTK.AA Protein Sugen 545 None Fasta, JSON
FASTK.NA RNA Sugen 1764 None Fasta, JSON

Protein domain

Protein domains of FASTK.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Show/hide domain list
Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
FAST_1 FASTK.AA FAST_1 273-341 36 1.6e-26 99.23 Pfam 1-73 (73) Show / Hide 
Range on Protein: 273-341
Range on HMM: 1-73/73
Sequence Identity: 36% (27 aa)

VQKLVLPFGRLN--YMPLE-QQFMPCLERILARE-AGVAPLATVNILMSLCQLQCLPFRALQFVFSPSFINHI
..||.|||.|||  |.| . ..|. .... | |. ... |...||...|.|.||| |.. .. ||.|.||...
ICKLLLPFARLNHVYKPPNMDEFFEKCHQHLHRHLHHFSPHDWVNLVWSCCMLQCFPVNFINQVFNPDFIQRL
FAST_2 FASTK.AA FAST_2 349-440 32 9.1e-33 118.63 Pfam 1-95 (95) Show / Hide 
Range on Protein: 349-440
Range on HMM: 1-95/95
Sequence Identity: 32% (31 aa)

IVRRYLSLLDTAVELELPGY-QGPRLPQRQ-RVPIFPQPLITDRARCKYSHKDMVAEGLRQLLG-EENYRQNLTVPPGYCTDFLLCVSSSGAVLP
..|..|. |..||.||.|.| |||.||.|.  .|....|.. ........... ..|.|.|||| |. .|.. . |.|...||.... . . .||
RTRMKLMHLNRAVCLECPEYIQGPWLPDRYCQQPSYLVPQCHKKEKRMSPLQQQMQEMLKQLLGGEQHFRHDVMTPYGWTIDFECHLDKNCQPLP
RAP FASTK.AA RAP 475-532 21 9.7e-13 48.13 Pfam 1-64 (64) Show / Hide 
Range on Protein: 475-532
Range on HMM: 1-64/64
Sequence Identity: 21% (14 aa)

LMLRERWHF--CRDG-RVLL--GSRALRERHLGLMGYQLLPLPFEELESQ-RGLPQLKSYLRQK
..   ..|.  .|.. . ..  |. ... |||  ||......|. | ..  ..  | ..||..|
IECDGPYHYNIYRNSDKHYTWNGNTKMKHRHLQKMGWKVIHIPYWEWNQLMKTKEQKMEYLKKK