Gene SgK223 (Human)
SgK223
Sequence
Protein domains of SgK223.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | SgK223.AA | NKF3 | 993-1324 | 60 | 1.3e-296 | 816.76 | In-house | 1-360 (360) | Show / Hide |
Range on Protein: 993-1324
Range on HMM: 1-360/360
Sequence Identity: 60% (224 aa)
TCNKPCCDSGDAIYYCATCSEDPGSTYAVKICKAP--EPKTVSYCS-----PSVPVHFNIQQDCGHFVASVPSSMLSS--PDAP----------------
||.||||.||||.|||||...||||.||||||..| ......||. .|.|||||||||||||.|.|||.||.. ||||
TCDKPCCRSGDAVYYCATHPKDPGSNYAVKICCDPNKAKQSQQYCHMTKVMQSHPVHFNIQQDCGHFIAEVPSRMLQWEDPDAPEKDEDDMEDTEEDAKA
----KDPVPALPTHPPAQE---------QDCVVVITREVPHQTASDFVRDSAASHQAEPEAYERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVHC
|.|.|.|.||||.|| |||||||||||||||..||||||.|.|..|||.|||.|||.|||||.||.|||||...|.||||||||||||
ETDGKNPSPCLETHPPQQENQRVMNRKQQDCVVVITREVPHQTVADFVRDSMAHHEHEPEVYERQVCFMLLQLCQGLCHLKEHHMCHCDLCLENLLLVHC
TLQAGPGPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAAGPASPEGPREKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTG
..|.||...|.||.....|. |.|||| ....|.|||||||||||||||||..||||.|.|.|.|||..|||||||||.|.||.|..|||||
QPQGGPHQGPTPADPTTTAR--CPSAAP--------CPTTACPEGPREKQLPRLIISNFMQAKQKSGHTVNPQQKRDQARLAPEIVTAKQYQKCHEFQTG
ILIYELLHQPNPFEVRAQLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKRVLQCL
|||||.|||||||..|.|||||||...|||..|..|.||.|||||||.||...|..|||...|||.||||
ILIYEMLHQPNPFDTRPQLRERDYTRDDLPRIPVRSPYSWGLQQLAHCLLNKNPQDRIRCNQAKRILQCL
|
|||||||||
| Kinase | SgK223.AA | Aur | 1117-1151 | 42 | 4.7e-09 | 19.51 | In-house | 100-134 (257) | Show / Hide |
Range on Protein: 1117-1151 Range on HMM: 100-134/257 Sequence Identity: 42% (15 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLL | | .. |.||.|... . .|||||. ||.|| EQRAAKYMYQICNALDYCHSKNIIHRDIKPENILL |
|||||||||
| Kinase | SgK223.AA | RSK | 1117-1151 | 45 | 1.8e-07 | 23.75 | In-house | 103-137 (278) | Show / Hide |
Range on Protein: 1117-1151 Range on HMM: 103-137/278 Sequence Identity: 45% (16 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLL |...|| . .. .||| ..||||||| .|| |. EDEACFYMAEIVLAVEHLHQQGIIHRDLKPENILY |
|||||||||
| Kinase | SgK223.AA | CAMK | 1117-1153 | 37 | 2.9e-07 | 18.7 | In-house | 178-214 (425) | Show / Hide |
Range on Protein: 1117-1153 Range on HMM: 178-214/425 Sequence Identity: 37% (14 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVH || .... |.| ..... .|.|.|||| .||.||.. EREARRYFRQICSAVHYCHSHNIVHRDLKPENILLDD |
|||||||||
| Kinase | SgK223.AA | DCAMKL | 1117-1152 | 41 | 2.9e-07 | 18.06 | In-house | 114-149 (279) | Show / Hide |
Range on Protein: 1117-1152 Range on HMM: 114-149/279 Sequence Identity: 41% (15 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLV || ....||. |..| | .|.|||. .||||.. ERDAAIMMTCLCKALKYLHEMNIVHRDIKPENLLVC |
|||||||||
| Kinase | SgK223.AA | S_TKc | 1007-1324 | 13 | 3.5e-07 | -71.65 | SMART | 16-231 (231) | Show / Hide |
Range on Protein: 1007-1324
Range on HMM: 16-231/231
Sequence Identity: 13% (48 aa)
YCATCSEDPGSTYAVKICKAPEPKTVSYCSPSVPVHFNIQQDCGH-FVASVPSSMLSSPDAPKDPVPALPTHPPAQEQDCVVVITREVPH--QTASDFVR
|... . | .|.|| | .. .| . .| .. .. . |.. ... ... . |. .
YKCRHKK-TGRIVAIKIIK-----------EHIRREIQILKK-HHPNIVKLYDVFQD---------------------DHLYMVMEYCDGDLGDLFDYIK
DSAA--SHQAEPEAYERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVHCTL---------QAGPGPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAA
. .. | | ...|.. |.|..||.. .|||||||| ||.|| . .. |
KRGRHGLRFPFP---E-HARFYMYQICCALEYCHSHGIIHRDLKPENILLDE-HIKICDFGLARQL----------------------------------
GPASPEGPREKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQT--------GILIYELLHQPNPFEVRAQLRERDYRQEDLP
. . .|||.. . . |...||.| ||. . . .
---------------------------------TTFCGTPWYMAPEVL---------GYGKCKCDWWSCGCILYEMLCGYPPFP-----QMQMMFKKIG-
PLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKR------VLQCL
|| . .. .|. || ||. . || . . .
--------SPEAKDFIRKCLQKDPEKRPTA-EALQDEWDIKCHPWF
|
|||||||||
| Kinase | SgK223.AA | AMPK | 1117-1151 | 48 | 5.9e-07 | 16.75 | In-house | 113-147 (254) | Show / Hide |
Range on Protein: 1117-1151 Range on HMM: 113-147/254 Sequence Identity: 48% (17 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLL || | .. | .|.| . .|.| |||| .||||| EREACRFFQQIISGVEYCHRHMIVHRDLKPENLLL |
|||||||||
| Kinase | SgK223.AA | RSK | 1117-1152 | 41 | 6.9e-07 | 20.86 | In-house | 100-135 (271) | Show / Hide |
Range on Protein: 1117-1152 Range on HMM: 100-135/271 Sequence Identity: 41% (15 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLV || |.| .. . . .|.| ..||.|||| || |.. EREVKFYMAEIALAMEYLHSQGIVHRDLKPENILYD |
|||||||||
| Kinase | SgK223.AA | Ciliate-C1 | 1126-1151 | 46 | 8.1e-07 | 13.14 | In-house | 137-162 (328) | Show / Hide |
Range on Protein: 1126-1151 Range on HMM: 137-162/328 Sequence Identity: 46% (12 aa) QLCNGLEHLKEHGIIHRDLCLENLLL || |... . . .| |||| .||.|| QLINVIQYIHQNNICHRDLKPENILL |
|||||||||
| Kinase | SgK223.AA | CAMKL | 1126-1151 | 42 | 8.2e-07 | 17.61 | In-house | 135-160 (297) | Show / Hide |
Range on Protein: 1126-1151 Range on HMM: 135-160/297 Sequence Identity: 42% (11 aa) QLCNGLEHLKEHGIIHRDLCLENLLL |.. ..... .|||.|||. .||.|| QIVSAVNYCHSHGIVHRDIKPENILL |
|||||||||
| Kinase | SgK223.AA | NKF2 | 1254-1311 | 31 | 1.4e-05 | 15.74 | In-house | 288-355 (365) | Show / Hide |
Range on Protein: 1254-1311 Range on HMM: 288-355/365 Sequence Identity: 31% (22 aa) GILIYELLHQPNPFEV----------RAQLRERD--YRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKR | ..|| . | ||| . | . |.. .||..| . |.|.|| .|| || || GAIAYEIFGQKNPFYSSSGGMAREQGEMHLDSCNSDYQEDQLPQMP--QSCPPVLRQLVYNLLQRDPSKR |
|||||||||
| Kinase | SgK223.AA | Pkinase | 1117-1153 | 43 | 3.6e-05 | 19.36 | Pfam | 107-143 (293) | Show / Hide |
Range on Protein: 1117-1153 Range on HMM: 107-143/293 Sequence Identity: 43% (16 aa) ERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLLVH |. ..| ..|.. |||.. ..||||||| .||.|... EWECKFYMYQILRGLEYCHSMGIIHRDLKPENILIDN |
|||||||||
| Kinase | SgK223.AA | NKF2 | 1118-1151 | 29 | 0.000829 | 9.32 | In-house | 182-215 (365) | Show / Hide |
Range on Protein: 1118-1151 Range on HMM: 182-215/365 Sequence Identity: 29% (10 aa) RRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLLL . . ...|. . || ||. |||. | |. WTRMMMIAQMLEACDHLHQHGVAHRDMKSDNILV |
|||||||||
| Kinase | SgK223.AA | AMPK | 1293-1323 | 32 | 0.061864 | 1.6 | In-house | 224-254 (254) | Show / Hide |
Range on Protein: 1293-1323 Range on HMM: 224-254/254 Sequence Identity: 32% (10 aa) SPGLQQLAHLLLEADPIKRIRIGEAKRVLQC || ..| . .|. ||.||| | . . . SPEAKDLIKHMLQVDPMKRITIHDIRNHPWF |
|||||||||