Gene n1214 (Tetrahymena)
n1214
Species: Tetrahymena
Alias: n1214, 1214, 1770.m00002
External Links:
Annotation:
Sequence
Protein domains of n1214.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.
Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.
| Domain | Protein name | Domain Name | Range | Identity (%) | Significance | Score | Profile Source | Profile Range (length) | Alignment |
|---|---|---|---|---|---|---|---|---|---|
| Kinase | n1214.AA | C8 | 2-36 | 57 | 2.9e-18 | 60.09 | In-house | 192-226 (226) | Show / Hide |
Range on Protein: 2-36 Range on HMM: 192-226/226 Sequence Identity: 57% (20 aa) VGNWAYMAPEILTKNDDQNKIYSKKSDSYSVGLLL .|.|||.||||..|.|.|.|.|...||..||||.| CGTWAYFAPEIEKKQDNQYKQYRIQSDLFSVGLVL |
|||||||||
| Kinase | n1214.AA | Ciliate-C8 | 2-36 | 61 | 5.3e-17 | 57.7 | In-house | 203-238 (238) | Show / Hide |
Range on Protein: 2-36 Range on HMM: 203-238/238 Sequence Identity: 61% (22 aa) VGNWAYMAPEILTK-NDDQNKIYSKKSDSYSVGLLL .|||.|.|||...| ...|..|.|||||||||||.| CGNWGYFAPEVEKKQSRIQSDIFSKKSDSYSVGLVL |
|||||||||
| Kinase | n1214.AA | STE-Unique | 1-36 | 30 | 8.4e-08 | 23.18 | In-house | 508-543 (616) | Show / Hide |
Range on Protein: 1-36 Range on HMM: 508-543/616 Sequence Identity: 30% (11 aa) MVGNWAYMAPEILTKNDDQNKIYSKKSDSYSVGLLL ..|. ||.||...... |. |. |.|..| | .. CCGTPCYMCPEVINCRNQINNPYDTKVDIWSLGCMC |
|||||||||
| Kinase | n1214.AA | TKL | 2-36 | 30 | 1.8e-07 | 22.97 | In-house | 234-279 (364) | Show / Hide |
Range on Protein: 2-36 Range on HMM: 234-279/364 Sequence Identity: 30% (14 aa) VGNWAYMAPEILTKNDDQNK-----------IYSKKSDSYSVGLLL .|. ..||||.| .... .. ||.|.| || |..| CGTPRWMAPEVLRGQMNYTEKVGIDEFCKGFEYSEKCDVYSFGIVL |
|||||||||
| Kinase | n1214.AA | Ciliate-E2b | 1-36 | 41 | 1.3e-05 | 13.2 | In-house | 165-200 (272) | Show / Hide |
Range on Protein: 1-36 Range on HMM: 165-200/272 Sequence Identity: 41% (15 aa) MVGNWAYMAPEILTKNDDQNKIYSKKSDSYSVGLLL ..| ||||||.. .| |. |.| .||| | IIGTPHYMAPEIIQSLQPGGKGYTYKVDIWSVGICL |
|||||||||
| Kinase | n1214.AA | MSK | 7-36 | 40 | 1.5e-05 | 14.74 | In-house | 171-200 (277) | Show / Hide |
Range on Protein: 7-36 Range on HMM: 171-200/277 Sequence Identity: 40% (12 aa) YMAPEILTKNDDQNKIYSKKSDSYSVGLLL |||||.|.. . |. |.. | .|.| .| YMAPEMLRRGYAQDGGYDEACDWWSLGVIL |
|||||||||
| Kinase | n1214.AA | Ciliate-E2 | 7-36 | 44 | 2.6e-05 | 14.18 | In-house | 253-286 (365) | Show / Hide |
Range on Protein: 7-36 Range on HMM: 253-286/365 Sequence Identity: 44% (15 aa) YMAPEILTKNDDQN----KIYSKKSDSYSVGLLL ||||||| . ...| | |..|.| .|.| .| YMAPEILNGKKYDNQQKQKGYDYKCDIWSLGVIL |
|||||||||
| Kinase | n1214.AA | LRRK | 1-36 | 43 | 3.3e-05 | 14.36 | In-house | 239-272 (351) | Show / Hide |
Range on Protein: 1-36 Range on HMM: 239-272/351 Sequence Identity: 43% (16 aa) MVGNWAYMAPEILTKN-DDQNKIYSKKSDSYSVGLLL .|||. .|||||. .| . . |. |.| || |..| CVGNPGWMAPEIMRYNGE---EEYTEKVDCYSFGMIL |
|||||||||
| Kinase | n1214.AA | STE | 1-36 | 35 | 0.000131 | 12.34 | In-house | 223-258 (359) | Show / Hide |
Range on Protein: 1-36 Range on HMM: 223-258/359 Sequence Identity: 35% (13 aa) MVGNWAYMAPEILTKNDDQ-NKIYSKKSDSYSVGLLL .|| .||||....|. .| |. |.| .|.|... FVGTP-WMAPEVIQQNGQGRDKGYDTKCDIWSLGCTI |
|||||||||
| Kinase | n1214.AA | ULK | 7-36 | 40 | 0.000335 | 10.88 | In-house | 213-242 (324) | Show / Hide |
Range on Protein: 7-36 Range on HMM: 213-242/324 Sequence Identity: 40% (12 aa) YMAPEILTKNDDQNKIYSKKSDSYSVGLLL ||||.|| .. | . |..|.| .|.| .. YMAPQILQGQGEQKPYYDYKCDIWSLGCIF |
|||||||||