CC1G_02529

Species: C.cinerea
Alias: CC1G_02529
External Links:
Annotation:

Classification

Group: Atypical
Family: Alpha
Subfamily: Alpha-Unclassified

Sequence

Name Sequence Type Origin Length Description Download
CC1G_02529.AA Protein None 74 None Fasta, JSON
CC1G_02529.NA RNA None 225 None Fasta, JSON
CC1G_02529.kin_dom Protein Kinase Domain None 42 None Fasta, JSON

Protein domain

Protein domains of CC1G_02529.AA. The domains are annotated by HMM profiles from Pfam and SMART, as well as in-house data which includes HMMs of each individual kinase group, family and subfamily. Here is domain list in details, including sequence identity, significance and alignment. In particular, you can find can find the best hit kinase group/family/subfamily, which is helpful to understand the relationship between kinases.Kinase domain and best hit kinase group/family/subfamily are highlighted in red and blue. Visualized by pviz.

Usage: Zoom in selected region by dragging mouse and zoom out by double-clicking.

Domain Protein name Domain Name Range Identity (%) Significance Score Profile Source Profile Range (length) Alignment
Alpha_kinase CC1G_02529.AA Alpha_kinase 3-32 35 2e-06 23.39 Pfam 189-225 (225) Show / Hide
Range on Protein: 3-32
Range on HMM: 189-225/225
Sequence Identity: 35% (13 aa)

HTEHKAS------GIGDFGEEGINKFVE-EHVCQEVC
||. .        | |..|.|||.||..  | | ..|
HTKDGNYEMDFDEGMGNLGQEGIEKFFQNQHKCNHIC

Kinase CC1G_02529.AA Alpha 10-32 36 5e-06 12.95 In-house 191-215 (215) Show / Hide
Range on Protein: 10-32
Range on HMM: 191-215/215
Sequence Identity: 36% (9 aa)

GIGDFGEEGINKFVEEH--VCQEVC
| |..|.||. .|   |   | . |
GDGNCGYEGMFRFFYTHHVQCNHYC