Protein (view, download) , Domain (view, download)
15295_Tthe             MDKNPLD-REN-IG----------------------------------------------
15633_Tthe             MSFLKIS-QTL-YE----------------------------------------------
1697_Tthe              MGNCCNK-DKD-GN----------------------------------------------
19624_Tthe             MGGKSKQ-KLIE--------------------FQVPRANLDLSSQQ--------------
21909_Tthe             MADNKIQ-QQK-YD----------------------------------------------
2238_Tthe              MEASQLI-----------------------------------------------------
23531_Tthe             MKNLYLQ-NLF-QN----------------------------------------------
23592_Tthe             MISQTED-YLN-LL----------------------------------------------
25761_Tthe             MEIYLQK-NISNLINQVILFHFISKTQQKFNKVDIQQK-LGIIQQQEKASKQERKQMSQG
26293_Tthe             MNSYSNK-LQN-YS----------------------------------------------
3866_Tthe              MGNNCCVPNQN-NG----------------------------------------------
6284_Tthe              MNSLTDN-IIA-LN----------------------------------------------
7169_Tthe              MSRNKT---PN-SS----------------------------------------------
7480_Tthe              MGNVCQN-QR--------------------------------------------------
8040_Tthe              MGQICSK-ICN-TT----------------------------------------------
8041_Tthe_Ciliate-E2b  MGQIASQ-LCN-QN----------------------------------------------
                       *

15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             PPQSLMMGSPVFLGNGKHSGSSSALGLQTQPHTSTQKKKYLIFIILAILLIIYNQYAQFC
26293_Tthe             ------------------------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             --------------------------------------A-DK------------------
15633_Tthe             --------------------------------------E-QRKKSGVLGL----VEKKIY
1697_Tthe              --------------------------------------T-E----SVGAK----S-SLQ-
19624_Tthe             --------------------------------------QGN----KEYLQIQQQH-QQSY
21909_Tthe             ---------------------------------------------TDYTQ----IRAQSY
2238_Tthe              ------------------------------------------------------------
23531_Tthe             --------------------------------------Q-R--RD---------------
23592_Tthe             --------------------------------------E-VS------------------
25761_Tthe             KNSQHNQLMIHGAQSEKRLNKIKFNGNGNSIGETTQNSA-S----SISYN----Q-SNQ-
26293_Tthe             --------------------------------------S-Q----TALHK----R-YQSP
3866_Tthe              -----------------------------------------P-SQMGYSF----L-NKNN
6284_Tthe              --------------------------------------Q-D----RSESQQ---Y-IQSN
7169_Tthe              --------------------------------------S-Q----FINGQ----M-SRE-
7480_Tthe              --------------------------------------E-Q----TVYEN----R-DKSP
8040_Tthe              --------------------------------------E-S----AKDSQ----Y-EQTP
8041_Tthe_Ciliate-E2b  --------------------------------------S-------KPNQ----------


15295_Tthe             --------SICDKF----------------------------------------------
15633_Tthe             VQ----------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             GN----------------------------------------------------------
21909_Tthe             APFQVT------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             --------SIKKHL----------------------------------------------
25761_Tthe             ---------------------------------NQ----------APFLQPISQDKNQQY
26293_Tthe             NS-------------------------------TNTNNYFLSANSKQ----------SQS
3866_Tthe              QE----------------------------------------------------------
6284_Tthe              QQLRIDLKQICKTSDSSKVKLDTQSSLQYTPQSN--------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              KK----------------------------------------------------------
8040_Tthe              K-----------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             QMYPLNNTNSNQSGTINYNEPREYYLQLQVGNHAQQQQREASNEMINLNGSQNNTAQFQN
26293_Tthe             ------------------------------------------------KGSQQNAYQGQQ
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             ------NLHLDDGQTN--------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             LNINNNLSNLNMNS---------------------------------------IQNGNQ-
26293_Tthe             QLASNSSAQHGQGQ---------------------------------------VQNGQS-
3866_Tthe              ------------------------------------------------------------
6284_Tthe              -----LRKHFRDGNFHNLDTQSYISSTTTSATRGFSLQNKLKDITNHAKLQEDYEDGESV
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             -------------------------------------------EKG-E-KVLLSSLVQKY
15633_Tthe             --------------------------------LSNKKLIQ--------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             -------------------IPNDE----IERSEENEKKFQDYLEKQQQHDDPREALLKQY
2238_Tthe              ------------------------------------------------------------
23531_Tthe             --------------------------------------------------LLLSYLLQSY
23592_Tthe             -------------------------------------------QKTKE-ELLFSCPVGKY
25761_Tthe             ------QVQ-SLVLKQLSNSRNNSSQKHLINQKKQRADSQ--------------------
26293_Tthe             ------SQQSHL-MVNAVNSPSSS----LQNQQQTMQGLQS------------------Y
3866_Tthe              ------------------------------------------------------------
6284_Tthe              CCYYKNTFTD-EILDDEVFMPQTR------------------------------------
7169_Tthe              -----------------------------------------------------------Y
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             NHV---NK-K---Q-------------ER-ILCITDKA---------VYNI---------
15633_Tthe             -----------------------------IVYDVNDEN-----------N----------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             -----ISSQNFG-----------------L----------QYQNNNYSS-----------
21909_Tthe             SKE---DR-P-----------------Y-KIVDLNNNC---------VYD----------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             TDL---AK-N---K-------------LL-MIIVDDKQ---------LHPY---------
23592_Tthe             NRK---DV-R---Q-------------DR-FIMITDKA---------FYNL---------
25761_Tthe             ---QNL------------------------------------------------------
26293_Tthe             TNTHNINN-NHP-----------------S-NNIQQQAVHLYTNQVSAA-----------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              -----FSN-REPHQSKLFWDKENRDQFHKI-KNIDTGQ---------EYDIRKKDDFQQI
7169_Tthe              KDE--LNQ-LVY-----------------I-IYLDEDN---------S------------
7480_Tthe              -----LQA----------------------------------------------------
8040_Tthe              -----INN-AIP-----------------I-NNLTHGE----------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             --------SPSKFLSKLISK---VVQVRIKR-----------------------------
15633_Tthe             -------LTCGWLLSEAIR--------KIHQ-----------------------------
1697_Tthe              -----------------------------IR-----------------------------
19624_Tthe             ------------------------------PSSFAISSSNSHQKYRSHSSSKILRTLENS
21909_Tthe             -------ARVEEDILKLTTINSMKSPSTIKN-----------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             --------QKQF---------------KSKK-----------------------------
23592_Tthe             --------KKT----------------SIKR-----------------------------
25761_Tthe             -----------------------------KT-----------------------------
26293_Tthe             -------Q---------------------FS-----------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              TDQVIPSI---------------------KI-----------------------------
7169_Tthe              -------I---------------------EV-----------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             -----RIP----------------------------------------------------
15633_Tthe             -----HQD----------------------------------------------------
1697_Tthe              -----RVP----------------------------------------------------
19624_Tthe             LSNNINNP----------------------------------------------------
21909_Tthe             -----NKP----------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             -----RIS----------------------------------------------------
23592_Tthe             -----RID----------------------------------------------------
25761_Tthe             -----RLSNQNISSNVQLNSSQKKNQAGLGISFNNQGTGNQYLWKNGLHKSFLSTQVPSG
26293_Tthe             -----QQP----------------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              -----EEP----------------------------------------------------
7169_Tthe              -----RVP----------------------------------------------------
7480_Tthe              -----RMP----------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             NSITSYNGNQVGSALSTQKAAHQLTNLQPLSNSQQSVNPMHQSVNLNNQSGNPQQHMLMS
26293_Tthe             ------------------------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ----------------LN-K----IFAVTIS---------------------------RF
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ----------------PQSQ----Q-----------------------------------
19624_Tthe             ----------------SD-QIFNSL-----------------------------------
21909_Tthe             ----------------T-WQ----DFWKNVKKCNIDLLDAAEIGNVDKIKYLLDKSKNLY
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ----------------KNSS----K-----------------------------------
23592_Tthe             ----------------LN-F----IKGITTS---------------------------TC
25761_Tthe             QQNTNTHQQMVLNLMIQQQQ----Q-----------------------------------
26293_Tthe             ----------------QQSQ----Q-----------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ----------------NQWS----QWWEKKKENQKEFEKACKLNLTDKIKELVQQTESDL
7169_Tthe              ----------------KDSS----V-----------------------------------
7480_Tthe              ----------------NN-Q----I-----------------------------------
8040_Tthe              -----------------NTQ----L-----------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ATQFIIHVPD-EHDYLLQSDDFRQKIIEVLCYSYCTLLQKKMAFFYKDDLTLMQFCT---
15633_Tthe             ------------------------KYLD--------------------------------
1697_Tthe              ------------------------------------------------------LQE---
19624_Tthe             ------------------------------------------------------CNQSAN
21909_Tthe             PVDLNYQSLDNYTALHFSVTDMHNQIVQILIDNGCNIE----------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------DQS---
23592_Tthe             GTEFVLHVPS-EYDYRYSSTLYREKIIQLLR-RYCGC----LAYFEKDEPQLKMYTT---
25761_Tthe             ------------------------------------------------------QHD---
26293_Tthe             ------------------------------------------------------IQS---
3866_Tthe              ------------------------------------------------------------
6284_Tthe              MPNLNAPINEGWTPLHYFAYFGNTPLCNLLIQKDINLD----------------S-----
7169_Tthe              ------------------------------------------------------A-----
7480_Tthe              ------------------------------------------------------YNQ---
8040_Tthe              ------------------------------------------------------LNS---
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             -------T----------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              -------T----------------------------------------------------
19624_Tthe             QGNVINNSQLQHSSSLNTAASSSNNNNNMSQLNLSSINTANMSCNSPSNFMNLQMSFQNG
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             -------T----------------------------------------------------
25761_Tthe             -------S----------------------------------------------------
26293_Tthe             -------S------------------------------------NQAATMNGHQNIQQSK
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              -------T----------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             KI--------------------------DAK-----------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              PT--------------------------PQQ-----------------------------
19624_Tthe             FTALNNSIQNPISPNPFTINNTSMIQNQQQITPISLNSQMNSSLYSVNNGQVSSQAQTSQ
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             NT--------------------------FN------------------------------
23592_Tthe             RK--------------------------DKK-----------------------------
25761_Tthe             PQ--------------------------QHQ-----------------------------
26293_Tthe             PSSAQ-----------------------KHN-----------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              KL--------------------------EQK-----------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             GFNIYSQQKLQILALEQMNKCIQLSSYKEAQKIIESNNITAEEIYSFKERSNENIILHSL
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ------------------------------------------------------------
26293_Tthe             ------------------------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             -------------------------IIEDTSSIVALIT-----------------DK-QD
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ALRQDSSVFLKYLDTHMTIEFNQVNSSGQTPLMLACMKGNYDVARFLVSHKSVDINSQDL
21909_Tthe             ----------------------AETTFKRRPLHLCCIIGNIDALKILIKHK-AEINPLDN
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ------------------------------------------------------------
26293_Tthe             ------------------------------------------------------------
3866_Tthe              ------------------------------------------------------LTKTAN
6284_Tthe              -----------------------VNIQGQTPLILACLENKQDVAALLIESG-ANINAQDQ
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             --------------------------------KKRSNLP---------------------
15633_Tthe             IS-TDFYLSQ--------------------------------------------------
1697_Tthe              --------------------------------KETGQIK---------------------
19624_Tthe             AGNSSLHYACMYGQRKIVEMLLGQKQVQSYIKNNDEKQPKDMTQDSKILQLFNKFRKVNL
21909_Tthe             NNNTPILLASQNRWHEIVEILLDNG-GDPHIKNNKGENAVNV------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             -NN-EGFCSS--------------------------------------------------
23592_Tthe             --------------------------------NNISRMP---------------------
25761_Tthe             --------------------------------QQQNQLQ---------------------
26293_Tthe             --------------------------------SN----S---------------------
3866_Tthe              QNN-PNFLSP--------------------------------------------------
6284_Tthe              YLNTPLHYCFLNGDKDLLDIILKKPYLDINLRNNNNKLP---------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              --------------------------------QQNGQL----------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             DQSYSSGSAAMNITLSYINKQDLTNTSQYKDSPRTN------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             --------------------QQQISLQGIQQL---ISKTNQGKGIQLGKSSGIPQSNRNN
26293_Tthe             ----------------LTNNQAQSSTSSYSNI---QSR----------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ---------------------SRSRQNNIQNSASNSQHHNNQLQRSHSNSSHSSNLQSLH
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             DLRSSYDQIQTQKNSIII------SRNNHSN-NEN-------------------------
26293_Tthe             -----------------LKQTKHKSQNNFTN-TSNSFNQSSQIPFGTSGNNHQSSLSHNQ
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             YNFVSKLNKSTTKNTFLTLKQALNSQNQ--------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ---------MKLMNDFQI---------YTPQNNLLANNENYNQASNINSTNLPSTTSNSK
26293_Tthe             YGTTATS--SSLSNQ--N---------KIGD-----------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ----------------------------------------------------TTISGQKN
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             QNPFYNNTATKNNGANSSIRLNSASKTNSRGTVSGTFNTTSHSNLLMGINKGLTINNQED
26293_Tthe             ------------------------------------------------KHKQMLVQSQQF
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             DSNPNSNKGSSVNSPIIKRHHSPNIHLQK-------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             SRRQNSAPKQQNFNIHTFNQQRNFNLKTEPSTVPISAVQNMSSLQQGVLGSQQK------
26293_Tthe             RHSTNSA----------------------------------------------LLRDSEL
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ---AKSAIHPPAVSTFFTQTQQQANSPTDFILKGLNQLNESQVNLGTSNNYVNNNPNNQT
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ------------------------------LYTYEGSLN---------------------
26293_Tthe             KHTSSNAPYIPSSARVKTDYSIERKGTSDLLLSNSSHQN---------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             NQTASQVLNNSISMNY--------------------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ---------------QSKANQNFIKIEQSNEENIYNLQFQNQIQSSSIKNGIAQQPYNLN
26293_Tthe             ---------------HSKQNAL---------------TSQLHSNSNTSANGITN-LYNQT
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             -----FDKNFMTPNNNNNNNQNNPNSYLSSAEGSNKNQPSQQLNYST-------------
21909_Tthe             ----------------------C-------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------SDYIKAHETIT-------------------------
25761_Tthe             TIDNQSSQDTASQMSNKQGNLS-----------QRN-GSKEQKDKQTAQSLSKQNTTEQL
26293_Tthe             MAAAQSSLNHANQQNSSQAAQVQSNQYLDNYNSQNN-FQQQQQNQQQ-------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ----------------------------------------------R-------------
7480_Tthe              ---------------------------------------------QD-------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              LVV--NLA----------------------------------------------------
19624_Tthe             LQQQNQQF--NQSMNALFNLQPFSQSKSMNN-------FLQSNTQSLNSIANQIHNPNTL
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             -QKS-ALS-------------------------------------------------KYY
23592_Tthe             NM-V-QMR-------------------------------------------------E--
25761_Tthe             SKE--QLDQEESLILNKQKIIQIYQQQQQKKKMSILEKAL--------------------
26293_Tthe             LQQ--QLQQNSQNLNNYRMILKKHKSQQMNE-------VL--------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              LTQ--RVKALAQQI----------------------------------------------
7480_Tthe              PTQS-EIR-------------------------------------------------EFM
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             TQMSQTSRQMTQGCNQMDNESGSLNYIPINYGMLESVNVSTNNFTPSQLQSNITTQN---
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             -----------------------------------------------------KEEDSDN
26293_Tthe             -----------------------------------------------------KTDP---
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             -----------------------------NIGEPINGKKSSQPNLSYVINNSSNLNGNQK
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             DEDEIQLDLNEKYKQKVKKTQDSDRNCQINL-----------------------------
26293_Tthe             ------------------NVGDYHANLTVFI-----------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------TD----------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             AEQTQLLSNGYENEGSAINNISLVSPSKSISNNTQYFNYKTPSQTINNNLNNGSQNHNST
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             ------------------------------------------------------------
26293_Tthe             ------------------------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             AKTQCNSPLLQSAQMQHHLNTINKIIEKKQRSRSQNQFSKAKSQV------GPIAVNQNN
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             --------------------------------------------KYKNETIH-YEFRTKE
26293_Tthe             --------------------------------------------HYKGKRIGPISLNAIG
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              ------------------------------------------------------------
7480_Tthe              -------------------------------------------------------LN--G
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ----------------------------ETVE-----------NQDTYQDTENIK-----
19624_Tthe             NNTNSQQSQAPSNAQAKISTFGTNAAASTPMNKDQAQENKNSSDSNESTNNTLQTASQQA
21909_Tthe             -------------------------------------------------DTQ--------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             KNVEWLFNF----------------ILRRLYYYEKN-VLKNEDEENITQSLQQIVSFVSS
26293_Tthe             GNVEWLTKQ----------------LINEILMYEQIQMPTNRDSNNESLDNDNILHFQSY
3866_Tthe              ------------------------------------------------------------
6284_Tthe              -----------------------------------------------YQES---------
7169_Tthe              ----------------------------------------------LFPNYENIVCLETV
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             ------------------------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             FHQSVSLKIQGSNNVSQTNILTNNSCGPLSATSKANFFNSQNQSTKNKQNSQQNVLGAGG
21909_Tthe             ----NMYDV---------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             -----------TN-----------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             -SQNIAVTYYLTQ-----------------------------------------------
26293_Tthe             QHRNISLSYYLTL-----------------------------------------------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              -SNEDLITYFR-------------------------------------------------
7169_Tthe              -GENEVIDYYLTQ-----------------------------------------------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ------------------------------------------------------------
15633_Tthe             -------------F---------------------------------ER-----------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             QYAFQSAYTSPQLQ---------------------------------SSSLQQFNNQIGH
21909_Tthe             -------------F---------------------------------MK-----------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             -------------PNLDNCEKLFMNHLEYEEKFSVKRMDDLSVSSSPII-----------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             -------------K---------------------------------KR-----------
26293_Tthe             -------------P---------------------------------ER-----------
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------Q-----------
7169_Tthe              -------------P---------------------------------NK-----------
7480_Tthe              ------------------------------------------------------------
8040_Tthe              -------------P---------------------------------QQ-----------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ---------------------------------T---CQPDMV--DPETMND--------
15633_Tthe             ------PLKYVKDGQILKPYYAGIQRQLL-SIN--FLIVKHVQ--IENFYPK--------
1697_Tthe              ---------------------------RLSS--------GSV----GSVGSR--------
19624_Tthe             IDQIFLNSQ------------------TN-N--------QNNL--QQNQ-----------
21909_Tthe             ------HKIYETEGFVLKDNFSNFNKKQN-GQN--QNEGGQVE--EGKVEEN--------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------KSQ------------------MI-Q--------QNIQ-------E---------
23592_Tthe             --------------KILGHNYTKEELKQN-TQPLFFNMNESCI--DFNIHAN--------
25761_Tthe             ------PIS------------------IFNN--------KCMH--IQPLYYD--------
26293_Tthe             ------PLD------------------PLFN--------KSLI--LEPFYGETSVTNSAS
3866_Tthe              -----------------------PD--QN-QQG--TK-VSQIS----SLRSH--------
6284_Tthe              ------QVQ----------------KKEL-Q--------RNIKAHMQIIEYD--------
7169_Tthe              ------KVN------------------QI-R--------ENIL--LKPVY----------
7480_Tthe              ------EIQ------------------NQ-Q--------QDIY-----------------
8040_Tthe              ------SVQ------------------QL-Q--------LSIK-----------------
8041_Tthe_Ciliate-E2b  ------ETD------------------PI-R--------QSLP-----------------


15295_Tthe             -----------------------------N--E---NAK-GKSD-LV----------FNR
15633_Tthe             -----------------------------N---------TN-RS--------------YK
1697_Tthe              -----------------------------S---------SSSSR-------------I-S
19624_Tthe             ----QALLKYLPHNKQSTPNQQSQNISQIQ---------PQQNF-------------QLS
21909_Tthe             -----------------------------N---------SEQGQRVSSPEKIRNLINKEG
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ---------------------------------------DP----LQ----------PPF
23592_Tthe             -----------------------------S--S-------NQAN-YQ----------DPL
25761_Tthe             -----------------------------F---------NLDTI-------------D-N
26293_Tthe             SSFNPSILA-------------Y------Q---------STSQT-------------DK-
3866_Tthe              -----------------------------S---------SQ-----------------QK
6284_Tthe              -----------------------------EEDLHNLFSNNQSIV-------------SNL
7169_Tthe              ----------------------------------------AQKS-------------DKA
7480_Tthe              ----------------------------------------MS-S-------------E-F
8040_Tthe              -----------------------------T---------EDQKT-------------VE-
8041_Tthe_Ciliate-E2b  -----------------------------P---------PPPPL-------------SN-


15295_Tthe             SDQNTKLSINDFHLIKVLGRGAFGKVMLCQKKD--TQDLFAIKSIRKEDII-EREQIEHT
15633_Tthe             FDDGNRITLKHFDVLKKIGLGGFSEVYLARRKD--NGQFVALKVIKKKTLI-KKRRKLYV
1697_Tthe              ANSRKNLSIQDFVIDRPLGKGAFGQVYLVTKKD--SQRKYAMKTIKKIDMV-KLQLIEAT
19624_Tthe             SNQSQLYGIEIYSVYAHLGSGNYGDVYLVEHNK--NKKKYAMKLLDKEKLI-QKNMMKYA
21909_Tthe             IIEMQKKTVQDYEYYRILGSGAFGKVILVKDKK--NQKYYAMKIISKEKFQ-QLNLMKYA
2238_Tthe              --KSSQ-LQQNYKVLELIGNGTYGDVVLAQDLRGNGDEQVAIKIIKNNKE-R-KNQISSI
23531_Tthe             QIKERQYCLEDFVFYKILGQGAFGVVFLSIDKQ--TNEEVAVKMISKHEIE-IKKQRDHT
23592_Tthe             NARKSVITLDDFDIIKVLGRGTFGKVMMVQKKD--TGVYYALKSIRKLKIQ-DEKQAEHL
25761_Tthe             TFQYREVGLESFHLIRCIGLGGFSRVYLVQKKD--TGKMFALKLIDKKFII-ENKKEVIV
26293_Tthe             SQQPYQVSLKDFHFIKCVGMGGFSRVYLVQKKD--NGKMYALKLIEKKFIL-TNKKEQIV
3866_Tthe              KVHQEKHPFDDYQKLANLGSGAYGEVSLVRKKK--DGKLYAMKVVKKEKVAINRKMVEAT
6284_Tthe              HSQSILNHTSQYIVHGLIGKGAFAEVFLVEERK--TGKQFALKMLHKQKII-EQNMYKYA
7169_Tthe              NQKEQELNIHDFTFLKCLGKGGTSDVFLVRHRE--SCKLFALKMIPKTHLS-EYKRLEQL
7480_Tthe              QRASQKISISDFRLEKVLGKGSFGKVMLVTHLV--EQKQYAMKVLLKKSIK-NERQKRHT
8040_Tthe              APKKKDLTYKDFDRLQNLGSGAYGDVILVKKKT--NNKQFAMKIIKKSKIV-SRNLNPQM
8041_Tthe_Ciliate-E2b  GVAKAQLSYNDFEIVKSLGQGAYGNVYQVQKKT--SNKQFAMKAIKKSKLL-QNGMDLQM
                                  :     :* *  . *              *:* : :

15295_Tthe             KTERKILEQ-VNFPFLVNLEYAFQTKEKL-----------FFAMKFVRGGELFFHLKKDK
15633_Tthe             YNEKNTMIALKDNPFIVQFFFAFQTREKL-----------IFVLEYCPGGELFYHLNQER
1697_Tthe              ILEKTILLK-SSHPFIVQLKYCIQTEKKI-----------YLIMEYIQGGELFTLLKHCG
19624_Tthe             IAERNVMQK-CNSPFIVKMYHSFQTDTHL-----------IITMDYCPGGDLYTYLLQKK
21909_Tthe             LSEKNAMSK-MQHPFIVKLHYAFQTKRKL-----------FLIQQYCGGGSLGRMLKIKQ
2238_Tthe              QNERIILEKCKNHPFFVQSKEFVKDKSCS-----------FFIMEYVQGGELYDIIQNRG
23531_Tthe             QTEKLILEH-IKHPFLINVLGTFQDCSVNNFSNQNTIIICFINNQSTEGGELFQHLKTQR
23592_Tthe             RMERYILES-INNNFLVKLKYTFQTDDKI-----------FFIMDFMKGGELFQHLKLNR
25761_Tthe             QNERNIMAS-IAHPFLLKLEYSFESKSYL-----------GFCMEYCAGGELFYHLRRIK
26293_Tthe             QNERNIMTMMQGHPFLLQLDYAFESKNYI-----------AFAMEYCAGGEMFYHLRKIK
3866_Tthe              LLEQKILKK-SRHPFIVKLSQSFQTEGKL-----------YIIMEYMANGDLYSVLQKVK
6284_Tthe              ITERNILQL-VDHPFIVKMHKAFQTKDKL-----------FFLLENGKRGDILQHLKFEK
7169_Tthe              LRERKILIDAAKAPFIASLHACFESEYHL-----------NFLLEFYCGGELFFHLQN-R
7480_Tthe              LTERQILEK-IDHPFIVKLHYAFQTNEKL-----------YLVLDFMVGGELFHHLKKSG
8040_Tthe              IIEKNVLLE-NKHPFLVRLKYSFQTEKKL-----------YLVMEYCPGGELYTYLVNNK
8041_Tthe_Ciliate-E2b  LMEKNVLLK-NKHPFLVTLKYSFQSDKKL-----------YLVMDLCKGGELLSYISQLN
                         *:  :       *:      .:                 :  .    *.:   :

15295_Tthe             K--FKESRALFYASQ--------------ILLALEYLHNQ-DIIYRDLKPENILLDQDGY
15633_Tthe             R--FKEEQAGILFAQ--------------ILEGIEFLHS-KNIIYRDLKPENILLDMNGY
1697_Tthe              Q--FTEKVAKFIIAE--------------IILGIQYLHETLKIIYRDIKPENILLTKSGH
19624_Tthe             R--FEEELAVKYLSE--------------ILLAVEELHYH-DVIYRDMKPENIVLGSDGH
21909_Tthe             R--FDEQTAKKYMCQ--------------IILAIEALHD-NLIIFRDLKPDNIVLDEEGN
2238_Tthe              H--LSEDAARFYASQ--------------VLIALDYLHQN-DIVYRDLKPENILLDENGY
23531_Tthe             F--FAEERVKFYAAQ--------------MILALEHLHSF-NIIYRDLKLENILLDEEGY
23592_Tthe             R--FNEQTAKFFAAE--------------VLLALEYLHSR-KIIYRDLKPENILLDEHGH
25761_Tthe             R--MSEEMARFYFVE--------------ICLGIDYLHKR-HIIYRDIKPENILLDLDGH
26293_Tthe             K--MTEEQARFYFIE--------------ICLGIDYLHDR-HIIYRDIKPENILLDIDGH
3866_Tthe              R--FDENTARFIFAENQMLSSCFEISYEHVILGLQYLHEEQNTMYRDLKPENILIGEDCH
6284_Tthe              K--FSESKAQFYAAE--------------VLLALEYLHNH-DIIYRDLKAQNILIAEDGH
7169_Tthe              K--LTENESKFYFVE--------------ILICFEYLHSN-KILYRDLKPENIVLDMDGH
7480_Tthe              K--FSEEVTRFYASQ--------------IVIGLEHLHQH-KIIYRDLKPENILLDSEGN
8040_Tthe              K--FSIEVSRFIAAE--------------VLLGLEYLHKSMKIIYRDLKPENILISEDGH
8041_Tthe_Ciliate-E2b  RLGISQEVAKFIGAE--------------VLLGLEYLQRKLKIMYRDLKPENILVCEDGH
                          :  .       :              :   .: *:     ::**:* :**::

15295_Tthe             VKITDFGLAKVLE-----------------------------------------------
15633_Tthe             VKLADFGLSKVLKS----------------------------------------------
1697_Tthe              IKISDFGLSKEFQN----------------------------------------------
19624_Tthe             VKLIDFGLSRENMG----------------------------------------------
21909_Tthe             AYLVDFGLAKLGV-----------------------------------------------
2238_Tthe              VKLTDFGLSEVEV-----------------------------------------------
23531_Tthe             LCLTDFGLAKILS-----------------------------------------------
23592_Tthe             IRITDFGMAKQFSTINEIPSLLKLVKVNSCISDGATNDSESWSSPKISQRSNQSNLSSAT
25761_Tthe             VRIGDFGLSKPDMD----------------------------------------------
26293_Tthe             IRIGDFGLSKPDMD----------------------------------------------
3866_Tthe              IKLSDFGLAKQFVN----------------------------------------------
6284_Tthe              VRITDFGLSKEGVRE---------------------------------------------
7169_Tthe              VRLTDFGLSKIGMH----------------------------------------------
7480_Tthe              LKLADFEN----------------------------------------------------
8040_Tthe              LKIADFGLAKQFKR----------------------------------------------
8041_Tthe_Ciliate-E2b  IKIADFGLAKHFYS----------------------------------------------
                         : **

15295_Tthe             ----------KGKLTNSLVGTPDYLSPEIINQ-----KGHNRTADYWAFGILIYEMVIGI
15633_Tthe             ----------KDQLNYTFCGSHEYMAPEMIQK-----KGHTFAVDYYSLGVLLYELVAGI
1697_Tthe              ----------KDEKTYTFAGTPEYLAPEIVLN-----KGHNKNVDLWGIGVFLYELVAGY
19624_Tthe             -----------EGVAQSFCGSAVYLAPEIISK-----KGHNKSVDWYQFGVLAYELMVGQ
21909_Tthe             ----------YDEINKSFLGTPAYLPPEIIVK-----DGHNRMADWYAVGIVLYELLMGC
2238_Tthe              ----------VSPTLDKICGTPEYVSPEMLFE-----SGYGKQVDHWALGVLIFEMITGH
23531_Tthe             ----------DTDTALTFCGTPEYLSPETIKG-----FGSSKASDWWSLGTLLYEMLFSM
23592_Tthe             SSPELQPANANRERTNSFVGTPQYISPEIIGR-----KSYTYSSDVWQFGLFIYELIYGY
25761_Tthe             ----------INEHAYSFCGSPEYMAPEMLMK-----VGHTYTVDFYCLGALLYELVTGL
26293_Tthe             ----------DNEFAYSFCGSPEYMAPEMLLK-----VGHAYPVDHYTLGALLYELVTGL
3866_Tthe              ----------KEDKENAFLGTPQYLAPEIVLQ-----KPYDKNIDLWTLGILLFELLSGK
6284_Tthe              ----------YDQGARSFCGSVAYMPPEILRN-----QGHGKSIDLYLLGIFIFEMLTGQ
7169_Tthe              ----------REEMTDSFCGSPEYMAPEVLLR-----QGYNYSVDFYTLGAFLYELVTGL
7480_Tthe              ------------APAHSLCGTPEYLAPEIITS----KVGHDKTVDWWSFGALVYEMLTGS
8040_Tthe              ----------EDELTTTLRGTPEYIAPEVILAEQ-TGKGYGLQCDIWAFGIFLFEIISGN
8041_Tthe_Ciliate-E2b  ----------ENEKCTTVCGTLEYLAPEIIQSLQPGFQGYGIEVDIWAFGIFLFEIISGQ
                                        . *:  *:.** :              * : .* . :*:: .

15295_Tthe             PPFFNNNQ--NVMFQ-L--ISEKDVKFPT-STPLSKECMDIIL-----------------
15633_Tthe             PPFSSDN--KTDLLE-K--ALTKEVKFPPKQ--FSSQLQDFIK-----------------
1697_Tthe              PPFQDKNRNYDKISK-Q--IIMNRPTYPE-N--FSPNLKDLIK-----------------
19624_Tthe             PPFNQLNR--KELYF-N--IQNKKVEYPP-Y--LSFKAKSLIS-----------------
21909_Tthe             TPFNQGNVSREVLYE-R--IKQNSIKIPS-N--ISSECQDIIQ-----------------
2238_Tthe              TPFEAKSQ--EELFE-K--IKFSQVTYPA-C--ISPQLKSLLE-----------------
23531_Tthe             PPFYHKQH--KQMFQ-K--IVFEELQFNP-NMQVSSQAKDLIGRVKYLIIQSINKIYFVK
23592_Tthe             PPFFHQQT--QIVFQ-L--IDECRIFFPQ-HIKISNECKDIIT-----------------
25761_Tthe             PPFYSHDT--DAIYQ-R--ILSEDLDFPD-HVELSIELKNLLK-----------------
26293_Tthe             PPFYSQIT--EEIYK-S--ILSEDLTFPD-HVNLSSELKNLLR-----------------
3866_Tthe              PPFGSG--K--NLMK-D--IIINKPIFPS-Y--FSAQAVDLIK-----------------
6284_Tthe              PPFYGKDE--QNILFIREHNLQQYLNESA---QISQFYFKDCQ-----------------
7169_Tthe              PPFYANNT--ETILK-N--IANEELEVPD-Y--LNPHLRELLY-----------------
7480_Tthe              PPFYSNNK--KQMLH-N--IIYKPIPIPK-N--LSDTAKSLLQ-----------------
8040_Tthe              PPFTDKNRNWAGIKQ-K--ILQNKPQFTA-D--FTEESQDLIC-----------------
8041_Tthe_Ciliate-E2b  PPFTHPKRNPEIIMK-K--VLQNKVQFPS-Y--FKEESKDIIL-----------------
                       .**         :                    ..    .

15295_Tthe             ---RLLKKDPNERLGSV-NGTKDIKEHPWFAKINFDEILNRKVPAPFVP--QLKSDT---
15633_Tthe             ---QLMIKDPTKRLGAK-SGISEIRKHPWCKKINFDKIRSLKFDPPIIP--RINMLNIDE
1697_Tthe              ---KLLNSDPQMRLGA--NSFTDLKEHPFFYDVDWEALENLKIESPIKK--FTQQEK---
19624_Tthe             ---ALLNKNPEERLGSGRADAQQIKDHPFFDQINWFDVKQKIFDMPKPP--APNPIK---
21909_Tthe             ---KLLCKNPKKRLGYK-NDGKEIRSHPWFEGIDWEKVIQKKIPMPKPVIRTIPNEP---
2238_Tthe              ---GLFMKNPSKRLGA--KGIEQIKKHPWFIKTSWESLKKKLLKAPYKN--LITKKL---
23531_Tthe             LKFQLLCKDPRIRLGSC-EGASELKNHPWFEDVDWDALYKRQVQAPFKP--VTNQEC---
23592_Tthe             ---KILQRDPEKRLT-----LQQAKMHPWFKDMDWEKLAKKQISSPYIP--CTQGEE---
25761_Tthe             ---GLLAKHPQNRLGIK-NGIRDILAHSWFKPIKIGDVLEKLIEPPLKP--NVLGFNFDE
26293_Tthe             ---GLLTKHPLQRLGQN-MGTKEILSHPWCRKINLADIIYKRIEPPVKI--DVMGFNFDE
3866_Tthe              ---KLLQNIGNKRLGS--NNFAELKSHPFFEKIDWDKIYRKELESLLKQ--YISKKPD--
6284_Tthe              ---KLANQNPRFRP-----TPDQIKRHPFFQGIDWKQLAQKNVKPPKSI--QLTQQM---
7169_Tthe              ---QLLDKRPNHRIK----SFEDIKSCKWFSDVNWKDILNLKIQPPIQI--DINQSYIHS
7480_Tthe              ---QLLVVNPKNRLGYGDNGTSDVKNHPFFATINWEAMKERKIKTPLNI--NVTDER---
8040_Tthe              ---KCLKDNPLERP-----NWDEIKVHPFFSKIDWEVLLSKGIESPLKK--LIPKRQ---
8041_Tthe_Ciliate-E2b  ---KCLQSNPQDRP-----TWDQLKNHPFFSSINWDDLYNKQVISPILK--HIPKRQ---
                                   *         :     :    .   :    .

15295_Tthe             ------------------------------------------------------------
15633_Tthe             GAVGENESL---IQEGN-------------------------------------------
1697_Tthe              ------------------------------------------------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             ------------------------------------------------------------
2238_Tthe              ------------------------------------------------------------
23531_Tthe             ------------------------------------------------------------
23592_Tthe             ------------------------------------------------------------
25761_Tthe             DEFNQGEKEFRK-KLLNCQVGQDEEHLPKIFEEFYFDSNLNR--IKKQK---QLQLQQLK
26293_Tthe             EEFSKGENEFKQ-KLMVSYYANND--FDPIFENFYYESPAVQQ---AQK---IRQEQQMK
3866_Tthe              ------------------------------------------------------------
6284_Tthe              ------------------------------------------------------------
7169_Tthe              --------EFREIQVPNITSRKNN--KESLFSFFYYVNPTSVKLLSRQNLLEIEIEKEPN
7480_Tthe              ------------------------------------------------------------
8040_Tthe              ------------------------------------------------------------
8041_Tthe_Ciliate-E2b  ------------------------------------------------------------


15295_Tthe             ---------------------------------D----VS--------------------
15633_Tthe             ------------------------AQYDNYLQQKLY--RSSHKMQINSFTDFNRQNSFKN
1697_Tthe              ---------------------------------PTK--AA--------------------
19624_Tthe             ------------------------------------------------------------
21909_Tthe             -------------