Protein (view, download) , Domain (view, download)
aur_Dmel         MSHPSDHV-LRP------------------------------------------------
ial_Dmel         MTLSRAKH----------------------------------------------------
AurC_Mmus        MVISWDLR----------------------------------------------------
AurB_Mmus        MAQKENAY----------------------------------------------------
AurA_Mmus        MDRCKENC----------------------------------------------------
air-2_Cele       MENKPPVI----------------------------------------------------
air-1_Cele       MSGKENTA----------------------------------------------------
IPL1_Scer        MQRNSLVN----------------------------------------------------
AurA_Hsap        MDRSKENC----------------------------------------------------
AurB_Hsap        MAQKENSY----------------------------------------------------
AurC_Hsap        MSSPRAVV----------------------------------------------------
Aurora_Ddis      MSYPNNKE----------------------------------------------------
12754_Tthe       MSQQQSYQ-LAT------------------------------------------------
13285_Tthe       MYSSLQQQ----------------------------------------------------
13287_Tthe       MRVNRNKE----------------------------------------------------
15246_Tthe       MMIDSSSS----------------------------------------------------
16602_Tthe       MSLSFYFQ-FYI---ETCELGQITFFNEPVDLQLVSNQLQKQSLSQYNQSSFQYDILPYS
18172_Tthe       MDFAKYFF----------------------------------------------------
19498_Tthe       MNQYIAFI----------------------------------------------------
19636_Tthe       YMQHLQPQSQNYVSEE--------------SKRIIDKIQTLRSSNQHF------------
22429_Tthe       PKLNQVKE----------------------------------------------------
25157_Tthe       MQPSNNLT----------------------------------------------------
26118_Tthe       MSNLKNCS----------------------------------------------------
26122_Tthe       MKTFDFNY----------------------------------------------------
5973_Tthe        MQNIGLNQ----------------------------------------------------
9766_Tthe        MFKCNRKQ----------------------------------------------------
Aur_Spur         MVCFNVSV----------------------------------------------------
CC1G_05421_Ccin  MTTASINS----------------------------------------------------
AqueK150_Aque    MAGVSTNI----------------------------------------------------
Aur-1_Smoe       MVEAPE------------------------------------------------------
GK043_Glam       MPQHLV------------------------------------------------------


aur_Dmel         --------------------------------------------------------KE--
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       --------------------------------------------------------SS--
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       LASNQTFNMSLILNLSSDSKISAIQNISVNIQITDLYLQIIGGSSLNLGYQNKMVLNTDS
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         -----------------------------------------------NAP-HR-------
ial_Dmel         -----------------------------------------------ANR-NH-------
AurC_Mmus        -----------------------------------------------DCQ----------
AurB_Mmus        -----------------------------------------------PWP-Y--------
AurA_Mmus        -----------------------------------------------VSR-P--------
air-2_Cele       -----------------------------------------------NL-----------
air-1_Cele       -----------------------------------------------PVI-D--------
IPL1_Scer        -----------------------------------------------IKL-NA-------
AurA_Hsap        -----------------------------------------------ISG-P--------
AurB_Hsap        -----------------------------------------------PWP-Y--------
AurC_Hsap        -----------------------------------------------QLG----------
Aurora_Ddis      -----------------------------------------------NSN-NI-------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       -----------------------------------------------NQY-NP-------
15246_Tthe       -----------------------------------------------SSK-SKLELKLIG
16602_Tthe       RDYEIQDPNQASNINFSWKCNSLSSNDHICYDYQNKQIQLQQGASSIAFP-A--------
18172_Tthe       -----------------------------------------------NTS-NT-------
19498_Tthe       -----------------------------------------------QQQ-GQ-------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       -----------------------------------------------RYI-YL-------
25157_Tthe       ------------------------------------------------YVPYY-------
26118_Tthe       -----------------------------------------------ISL-PM-------
26122_Tthe       -----------------------------------------------NQS-AL-------
5973_Tthe        -----------------------------------------------VKD-RI-------
9766_Tthe        -----------------------------------------------CVY-ND-------
Aur_Spur         -----------------------------------------------TYC-VL-------
CC1G_05421_Ccin  -----------------------------------------------VTR-Q--------
AqueK150_Aque    -----------------------------------------------RTL-TT-------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         --------------M-P--EKSAAV--------------------HNMQKN---------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ---------------------------------------------SA-------------
AurB_Mmus        ----------------G---SKTSQ--------------------SG-------------
AurA_Mmus        ----------------V---KTTVP--------------------FG-PKR---------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        --------------NSP---SKKTT--------------------TR-P-----------
AurA_Hsap        ----------------V---KATAP--------------------VGGPKR---------
AurB_Hsap        ----------------G---RQTAP--------------------SG-------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      --------------G-G--GSFSVP--------------------SKQPQR---------
12754_Tthe       -------------------KEDQSN--------------------QKLQE----------
13285_Tthe       ----------------------PNN-------------------YGG-------------
13287_Tthe       --------------Q-Y---LSPND-------------------YNQ-------------
15246_Tthe       PQSSRNQLRQSNNMT-NGNLSTNSQ-----MGFNTTCNTAR----NQ-QN----------
16602_Tthe       --------------------KTFQP------------------------YT---------
18172_Tthe       --------------S-F---FKSSN---------------S----NE-AN----------
19498_Tthe       ----------------F----------------------------NS-------------
19636_Tthe       -----------------KSSSDVKY-----QNSNYTDNQTI----QSKPII---------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       --------------Q-P----------------------------LSSPKLPFQQGQLQQ
26118_Tthe       --------------K-N---QQPIEQSIKLFQVSDSSKLKQQQLKQK-------------
26122_Tthe       --------------Q-N---QQKLK--------------------NG-------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        --------------D-S---KS--Q-------------------A---------------
Aur_Spur         --------------C---------------------------------------------
CC1G_05421_Ccin  ----------------I---AALEI-----------------------SN----------
AqueK150_Aque    --------------Q-V---KGMTL--------------------GSASN----------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ---------------------------------------------------LL----LGK
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ---------------------------------------------------VL----VTE
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ---------------------------------------------------VL----VTQ
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ---------------------------------------------------VL----QQQ
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ---------------------------------------------------IIQFTVVGQ
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       THQFNLSKPTNTLSGQTSIGQTVFTSTTNVTTVFPTVNTLNYSNMPFQNSNAL----IHQ
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         K------------------P-N--------------SE----------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        Q---------------------IP------------SQ----------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        Q---------------------FP------------CQ----------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      N------------------T-N--------------IN----------------------
12754_Tthe       A------------------P-N--------------NSSSNQDNSNKYLEKIIQQYKETT
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       V------------------T---PKRQNSNHNGNSVN-----------------------
16602_Tthe       KDSRQSNFTTTCIFTELDIP----------------------------------------
18172_Tthe       N-----------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       K-----------------------------------TG----------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  K------------------KQ---------------GG----------------------
AqueK150_Aque    K-------------------ENAT------------SS----------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       KSSSQTHTPSSFGNSQYTNTNISNISSLKTEEAALKNQLASIGDQGNTNQVDQK------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       -------------QASNFNINQNNMNACNTASSNYSSLLNGTPSSLNTQMNNRMQGNSYL
16602_Tthe       ------------------------------------------------------------
18172_Tthe       -----------------SK-----------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       --------------------NEFQGQQASTLQAAMKKQAQGIQQKANTNSNNQ-------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         -----N------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        -----N------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        -----N------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      -----N------------------------------------------------------
12754_Tthe       ----NN--------------------------FSNLPPMIPKVSKPGEPSSLGQLGQNS-
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       NKTSNNGSSVSKLSNQNFSKKSGSGLGSNLGSTKSYQNNQNHHSGSIVGNYTGSSLNQN-
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ---LYQITGTQTAQKNYLQVGKIDLDAILSANKKQSQLAQTQNQYQPQGIVTQREVNKRQ
22429_Tthe       ------------------------------------------------------------
25157_Tthe       -----N------------------------------------------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  -----G------------------------------------------------------
AqueK150_Aque    -----Y------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ----------------------QISIENINNLKNSATKLNQNVQNLTTVEPYEPYRKNAH
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ----------------------QGSTFSKEKMNTVMKNNMSKQKTNSNMHMTHKNQILQQ
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       TLPPDRRSFQDQFNTTPQQCTNNSNIAYNQPQQ---------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         -----------M-----------------------------------AP-----------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        --------------------------------------------------I---------
AurB_Mmus        --------------------------------------------------LNT-------
AurA_Mmus        -----------L-----------------------------------GSASSG-------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        -----------P-----------------------------------LPVNSG-------
AurB_Hsap        --------------------------------------------------LST-------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      -----------H-----------------------------------QT-----------
12754_Tthe       QRQSSMIHLNGS-----------------------------------SS-----------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       YQASQQQFIQQQLQQLSYANNQQSHSQLN-----QLMDQSPNQTYHLSPST---------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------HTLKQAATQVSNINATQSQSSISKVGSNGLINQSQNAIYQQQPSI---------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       -----------I-----------------------------------TSSSAGNTNYLKS
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  -----------I-------------------------------------SSSS-------
AqueK150_Aque    -----------Q-----------------------------------LGSNYR-------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        --------------------------------------L---------------------
AurA_Mmus        --------------------------------------Q---------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        --------------------------------------N---------------------
AurA_Hsap        --------------------------------------Q---------------------
AurB_Hsap        --------------------------------------L---------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       --------------------------------------Y---------------------
13287_Tthe       --------------------------------------Y---------------------
15246_Tthe       --------------------------------------S---------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       --------------------------------------I---------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       PILNSAQITATSSTAGSLQNSNLVNSIAFNEFQNNQNIQAQNQMLNSRNTRSPTSKGAGP
26118_Tthe       --------------------------------------I---------------------
26122_Tthe       --------------------------------------T---------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        --------------------------------------N---------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  --------------------------------------S---------------------
AqueK150_Aque    --------------------------------------L---------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       LPALRSSSSKHSNEIQNDKQFDIKAYINKQSFAGSATFDSKPIFFSSLTNSFQPPSINNI
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         --------------------------------------------LPHL----L-------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        --------------------------------------------SQRV------------
AurA_Mmus        --------------------------------------------AQRV------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        --------------------------------------------TSRI------------
AurA_Hsap        --------------------------------------------AQRV------------
AurB_Hsap        --------------------------------------------PQRV------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       --------------------------------------------SDYQ------------
13287_Tthe       --------------------------------------------NNAF------------
15246_Tthe       ----------------------QQQINTNENTKVKSSYLSSKPTSPHS----YLGNSDTQ
16602_Tthe       ------------------------------------------------------------
18172_Tthe       --------------------------------------------IQQN----I-------
19498_Tthe       --------------------------------------------TQNI------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       PTSSNNITTTTNIQKQNNQNNNFEIQIINRNGFFEVNCESIHQQSQEI------------
26118_Tthe       --------------------------------------------DNNIQKKPTPQIFQDT
26122_Tthe       --------------------------------------------SSQI------------
5973_Tthe        ----------------------------------------------LI------------
9766_Tthe        --------------------------------------------QSII------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  --------------------------------------------SSSS------------
AqueK150_Aque    --------------------------------------------GQK-------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       DFQKFSQPSNIKESGYFSNPFGQSLSSTNNSKSNKCMTPINEKSSKSQNSYLKKSQLIVT
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       SNLPQAQLIYLNNQGLTPGSQQSSTTFGAKWSPVKATKVQADEDCILTQRNQNLANAQEN
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         --------------------------------------------A---------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        -----------------------------------------L------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        -----------------------------------------L------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       --------------------------------------------SSQLQSLVAKGSDTTT
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       SKNQNSSNMLNTSTNNSNTSFLKQSHSRSPLSSNHIEKENNYL-----------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       -----------------------------------------L------------------
26118_Tthe       IKNYQIAQTKSSKENTIQSVFTQNTLQASQQKIYHHHKNFQSCGGINLGQFNQQMHPQFI
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  -----------------------------------------FRPG---------------
AqueK150_Aque    -----------------------------------------T------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       NNQANSNSQQQQAGMKLSQ--TLGENSIKQLVANKIDAIKKQQ--DINS-AANSQFKKEF
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       -------------PLNIFTATH--------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ---------------NIIQTSNFQNNSSQQLD--DLDKYKKQMQQKIVSTTPSKQLLHSY
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       DQDNLISPNQSVKNSRML------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       INQF--------------------VATQSGHSNSTDILNKQSRLSFQGDLTPVIPYESYY
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       QNQSHMNINTPKGNNRSQNSSEANILYFKGNISSH-------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       ------------------------------------------------------------
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         -------SK-------------------------P--L----------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        -------------------------------------C----------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        -------------------------------------C----------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       TKQQMRNSK-------------------------K--L----------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       --------DLASNQQSRIQSDSQLNLHPSPMKQQN-------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       -------------------------------------S----------------------
26118_Tthe       NSTHSTN---------------------------NFILNRKDSGNLINNQNVQLNDTLAQ
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  -------HT-------------------------K--Q----------------------
AqueK150_Aque    -------------------------------------A----------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       VSNGSSQQNLNINNVSNIGVYNPLSNMSSPLNQSVNVFLQSTRNNKQIEEAAYKQQQLPI
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ------------------------------------------------------------
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       ------------------------------------------------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       KDQQKQISSTFNQFPQSHRVSQVQSKSISSIQQIGINLEQLISPQSNLQDKTRSFTPNQR
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       ---------ENTNESLKQQNKDIGSSITNNLLQQKSDQKEKKLLTQSQFDLQLQKYKQSL
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       --------------------SQQNKFV-----------------NNDSSQQITQNQNQAF
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ---------K--------------------------------------------------
26118_Tthe       AANGIESKIKKNQNCFLNNQQISNSIRTQKQNYIQYSNYPMNLIEEENLEQIDKLIIKNN
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         ------------------------------------------------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        ------------------------------------------------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        ------------------------------------------------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       MNNLNLDTSKINESEKKQELSGSSALLADSVINLTESITGQNQSKQISSIQVPASKVQDS
13285_Tthe       ------------------------------------------------------------
13287_Tthe       ------------------------------------------------------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       KNLIQNPDQQNFMNISSFKYQKPPVSSDSITNNEVKKQQQQQQQQQQLQQSQQQQNNQQF
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       TGPNAQKVQDKKIFSEDTYKNEVKQVSLKQLSLNNLQGGQHAQGVNLSNHLQNNQQSKVN
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ------------------------------------------------------------
9766_Tthe        ------------------------------------------------------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  ------------------------------------------------------------
AqueK150_Aque    ------------------------------------------------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ------------------------------------------------------------


aur_Dmel         -----------------------------------------P------------------
ial_Dmel         ------------------------------------------------------------
AurC_Mmus        ------------------------------------------------------------
AurB_Mmus        ------------------------------------------------------------
AurA_Mmus        -----------------------------------------P------------------
air-2_Cele       ------------------------------------------------------------
air-1_Cele       ------------------------------------------------------------
IPL1_Scer        ------------------------------------------------------------
AurA_Hsap        -----------------------------------------P------------------
AurB_Hsap        ------------------------------------------------------------
AurC_Hsap        ------------------------------------------------------------
Aurora_Ddis      ------------------------------------------------------------
12754_Tthe       FSDRLLHFQYTSKNPAANNSAIESPDGSAKNSQQNQLKSHVP------------------
13285_Tthe       ---------------------------------------NRPI-----------------
13287_Tthe       ---------------------------------------ATPY-----------------
15246_Tthe       ------------------------------------------------------------
16602_Tthe       ------------------------------------------------------------
18172_Tthe       ------------------------------------------------------------
19498_Tthe       ------------------------------------------------------------
19636_Tthe       SGQNLLNVKNIQFQYIDQSLNVSKNNSNTGSIHQNIPNSPQS------------------
22429_Tthe       ------------------------------------------------------------
25157_Tthe       ------------------------------------------------------------
26118_Tthe       LSNNNIAVQTPQNSNSNQYSQNALIQQLLAPFQPNKQINQQPQQQQQQQQQQQKYQQFTQ
26122_Tthe       ------------------------------------------------------------
5973_Tthe        ---------------------------------------L--------------------
9766_Tthe        ---------------------------------------YKPC-----------------
Aur_Spur         ------------------------------------------------------------
CC1G_05421_Ccin  -----------------------------------------P------------------
AqueK150_Aque    -----------------------------------------P------------------
Aur-1_Smoe       ------------------------------------------------------------
GK043_Glam       ---------------------------------------------