Protein (view, download) , Domain (view, download)
Doa_Dmel         MCVRFQMPRT--------------------------------------------------
CLK4_Mmus        MRHSKRT-----------------------------------------------------
CLK3_Mmus        MPVLSARRKRLASTAGPR-RG------------S--------------------------
CLK2_Mmus        MPHPRRYH---SSERGSR--G------------S--------------------------
CLK1_Mmus        MRHSKRT-----------------------------------------------------
E02H4.3_Cele     MPILHQKI---ASTGGQPSTN------------S--------------------------
C16A11.3_Cele    MEHDSSEDSD--QFEPPR--APVSS-----------------------------------
KNS1_Scer        MSQNIQIGT---------------------------------------------------
CLK4_Hsap        MRHSKRT-----------------------------------------------------
CLK3_Hsap        MPVLSARRRELADHAGSG-RR------------S--------------------------
CLK2_Hsap        MPHPRRYH---SSERGSR--G------------S--------------------------
CLK1_Hsap        MAAGRRPA---SALWPER-RG------------SPL----RGDLLGFQNVREPSSCGETL
Y111B2A.1_Cele   MKRASTCLQH--HSLPAK--K---------------------------------------
ClkA_Ddis        MDRFQTKRKTYSYNGYSN--N------------D--------------------------
22369_Tthe       MGSKDRTKNYRE-YRGSI--S------------KKYKNNQSGNYSKFQN-RQNSRSRSRS
CLK_Spur         MSRGASSPDS---IHGMP------------------------------------------
CC1G_01467_Ccin  MLASDRGHS---VQYS----ALVQDL----------------------------------
CC1G_10232_Ccin  MDTTPLLPPG--LSFPYR--RNGSRFELWLIKMS--------------------------
CC1G_15475_Ccin  MLPAHELKR---------------------------------------------------
CC1G_06417_Ccin  MSAAVHPLNPHHISHYSR--S---------------------------------------
AqueK109_Aque    MLTTMCVRGNA-------------------------------------------------
CLK_a_Smoe       MLIDIWLVQFA-P-AG--------------------------------------------
CLK_d_Smoe       SPPW--------------------------------------------------------
CLK_b_Smoe       MVGT--------------------------------------------------------
CLK_c_Smoe       MVTAAALQV---------------------------------------------------
GK028_Glam       MALSSRPNT---ARR---------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        -GPSLAVRWVPPLGPEPSSDRGRAPMR----------------------PRGPT---CST
CLK2_Mmus        -----------------------------------------------------Y------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     ----LALRRLP-------------------------------------------------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        -GPSPTARSGPHL----SALRA-QPARAAH-LS----------------GRGTY---VRR
CLK2_Hsap        -----------------------------------------------------Y------
CLK1_Hsap        SG----------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        -----------------------------------------------------YGYYN--
22369_Tthe       Q-----------------QQRN-APAQYQNSFQNNEKLRYDNNNNRYQQNQYSQ---NDR
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  -----------------------FPLL---------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        TRRGAGRGPRLLPGPPGRD---------LHRCRPDPGGAGQSPRVCEFGARAVRPLGRVE
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     ------------------------------------------------------------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        DTAGGGPGQARPLGPPGTS---------LLGRGARRSGEGWCPGAFESGARAARPPSRVE
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       DFRGGSVERRYDQGPNNQYSRNEGRDNNNFGRNNYKNDTGY-------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ---------------------------------------------------RRL------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        PGPPTAASREGAVLPRAEARAGSGRGARSGEWGLAAAGAWETMHH-----CKRY------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     --------------------------------------------LVVIPRKRKY------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        -------------------------------------------------R-KRS------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        PRLATAASREGAGLPRAEVAAGSGRGARSGEWGLAAAGAWETMHH-----CKRY------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------MRH-----SKRT------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        -----------------------------------------------------NNCSNVN
22369_Tthe       -------SRGG-------------------------------------------------
CLK_Spur         --------------------------------------------V-----AHCM------
CC1G_01467_Ccin  ---------------------------------------------T-----IFA------
CC1G_10232_Ccin  --------------------------------------------FT-----ILL------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------LD----PR-RRV------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------PN----------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         -----H--HSR--------DRS--------------------------------------
CLK4_Mmus        -----H--CPD--------WDSRE--------------------------------SWGH
CLK3_Mmus        -----R--SPE--------PDP--------------------------------------
CLK2_Mmus        -------------------HEH--------------------------------------
CLK1_Mmus        -----Y--CPD--------WDERD-------------------------------WDYGT
E02H4.3_Cele     -----KNYVSR--------RRN--------------------------------------
C16A11.3_Cele    ----------I--------KIECQ---------------------------------CGT
KNS1_Scer        -----R--ANM--------NNSTT---------------------------------TGP
CLK4_Hsap        -----H--CPD--------WDSRE--------------------------------SWGH
CLK3_Hsap        -----R--SPE--------PDP--------------------------------------
CLK2_Hsap        -------------------REH--------------------------------------
CLK1_Hsap        -----Y--CPD--------WDDKD-------------------------------WDYGK
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        YNNDIH--YKNNNYNNNNNNNNSNSGNNFNNNNNNNNNNNNNNNNNNNNNNNNNNYTYGN
22369_Tthe       -------------------------------------------------------RDYSP
CLK_Spur         -----H--CTQ--------HCT--------------------------------------
CC1G_01467_Ccin  ---------------------------------------------------------YGE
CC1G_10232_Ccin  -----H--LEL--------DDLRQ---------------------------------LGA
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  -----N--LPA--------VTQSI---------------------------------AGP
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       -----L--CN-----------SSY---------------------------------AWP
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------S-----------------
CLK4_Mmus        --------------------------------E---------S-----------------
CLK3_Mmus        ------------------------------------------Y-----------------
CLK2_Mmus        ------------------------------------------Y-----------------
CLK1_Mmus        --------------------------------W---------R-----------------
E02H4.3_Cele     ------------------------------------------TQLLASLRRCVSDPN-VY
C16A11.3_Cele    N--------------------------------------NTNN-----------------
KNS1_Scer        ANNT--------------------------------------------------------
CLK4_Hsap        --------------------------------E---------S-----------------
CLK3_Hsap        ------------------------------------------Y-----------------
CLK2_Hsap        ------------------------------------------Y-----------------
CLK1_Hsap        --------------------------------W---------R-----------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NNNNNSNNNNNNINNNGNSNNNNNNSNGSENNY---------F-----------------
22369_Tthe       --------------------------------QR--------SNGVDSRRKSLSQKNQR-
CLK_Spur         ------------------------------------------L------RTCLV------
CC1G_01467_Ccin  SDR-----------------------------YLSILPFVRAL-----------------
CC1G_10232_Ccin  T--------------------------------------SQRL-----------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  SVMA----------------------------N---------A-----------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       TSS---------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     KSYNHWKALLRPMTPIKSGAPTPKTVTPMPVPQIPPHQKMTPNPTPTQNPVQLPLPHAVS
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       ------------------------------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     EKPGDKKSTGPT-PSPVPSKAPISAAKLPGTVTKVAPLLSAAQPPPKT------------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       ---------YYSQNQYSQGGN-------------------QAQSYPYQQNSFNQAQQSHY
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     -------LAPAPGASETNSGSGPVSKQVSGKLTEL--K-------------------SKN
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       GNSYPNHQQSSYNNNNNNSNSNYKKENVEDYYKNRDYKDWNNRDGNRNDRQNNNYSSNNN
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     GTVTEKTEKAVLRIPSSAST--RAKAASAVAPEANPAPVPTATKPSPFAPAIAPLRDGAP
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       GNHNNSNNSRFTNNPSGHSTINNS------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     AQPPAPIQASAPLRPPVAKQNSLQKPPEPKRSVGAPPKALPSELVNKIDGIEFLPQS---
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       -------------------NNSYDKRNESYRQAN----TFPSDQYSRGNGSGNGNQNSFN
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     -------------------SNQNTDDGQQ-------------------------------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       KNDNNSNYNSYNGNRSYKNEYQNSSQGHKQYGNNNNNYDNKRVSSQNYRNLTGGGGSYNN
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ----------------------AGTRDK-R------------------------------
CLK4_Mmus        ----------------------YSGSHKRK------------------------------
CLK3_Mmus        ----------------------LSYRWK-R------------------------------
CLK2_Mmus        ----------------------QSRKHK-R------------------------------
CLK1_Mmus        ----------------------SSSSHKRK------------------------------
E02H4.3_Cele     -------------------PTTSTGGAKAL------------------------------
C16A11.3_Cele    ----------------------RLI-----------------------------------
KNS1_Scer        ------------------------SSNKTF------LDNFEETRTNKLLDEMFARQNSFL
CLK4_Hsap        ----------------------YRGSHKRK------------------------------
CLK3_Hsap        ----------------------LSYRWK-R------------------------------
CLK2_Hsap        ----------------------RSRKHK-R------------------------------
CLK1_Hsap        ----------------------SSSSHKRR------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ----------------------QSENQS-N------------------------------
22369_Tthe       NGNFRRSNSNRNRSNNNYKNYG--------------------------------------
CLK_Spur         ----------------------QGTSHQ-VGTPVAIV-----------------KGG---
CC1G_01467_Ccin  ----------------------RGMVNV-R------------------------------
CC1G_10232_Ccin  ----------------------RNLINAYR------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ----------------------SPVTTRKR------------------------------
AqueK109_Aque    ----------------------DGVSDK-K------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ----R-RHDT-------A----------------------DH-SPP--------------
CLK4_Mmus        ----R-RSHS-------S----------------------TQENRH--------------
CLK3_Mmus        ----R-RSYS-------R----------------------EHE-GR--------------
CLK2_Mmus        ----R-RSRS-------W----------------------SSSSDR--------------
CLK1_Mmus        ----K-RSHS-------S----------------------AREQKR--------------
E02H4.3_Cele     ----R-RAYG-------S----------------------KSGTTI--------------
C16A11.3_Cele    ----------------------------------------------KC------------
KNS1_Scer        TDNLR-NSLD-------L----------------------NQADNP--------------
CLK4_Hsap        ----R-RSHS-------S----------------------TQENRH--------------
CLK3_Hsap        ----R-RSYS-------R----------------------EHE-GR--------------
CLK2_Hsap        ----R-RSRS-------W----------------------SSSSDR--------------
CLK1_Hsap        ----K-RSHS-------S----------------------AQENKR--------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ----K-DQNS-------Y----------------------FNSSYL--------------
22369_Tthe       ---------------------------------------------R--------------
CLK_Spur         ---NKGLHLM-------SEIGTEMTGISMPKITGLADIALGAENTT--------------
CC1G_01467_Ccin  ----R-LSLH-------V----------------------SSDNTDYI------------
CC1G_10232_Ccin  ----R-RVWYFPRFLTAW----------------------HL-----GPDIFLAKMELTG
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ----K-RAHQ-------Y----------------------TVSYS---------------
AqueK109_Aque    ----K-S-SS-------L----------------------SSLSTS--------------
CLK_a_Smoe       --------------------------------------------QT--------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------L-----------------
CLK4_Mmus        ------------------------------------------CKPHH-------------
CLK3_Mmus        ------------------------------------------LRYPS-------------
CLK2_Mmus        ------------------------------------------TRR---------------
CLK1_Mmus        ------------------------------------------CRYDH-------------
E02H4.3_Cele     ------------------------------------------CA----------------
C16A11.3_Cele    VGCAQWQHAVCMGVRPTDCVTAYKCEDCEPRLLIVTIAEAESFQGVK-------------
KNS1_Scer        ------------------------------------------L-----------------
CLK4_Hsap        ------------------------------------------CKPHH-------------
CLK3_Hsap        ------------------------------------------LRYPS-------------
CLK2_Hsap        ------------------------------------------TRR---------------
CLK1_Hsap        ------------------------------------------CKYNH-------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------RNPVDNYNHNNNNHNNNA
22369_Tthe       ------------------------------------------DNNNF-------------
CLK_Spur         ------------------------------------------ENL---------------
CC1G_01467_Ccin  LYCLHREGQL--------------------------------SLPRR-------------
CC1G_10232_Ccin  AICAGWQALR--------------------------------FLDRL-------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    --------------------------------------------LPM-------------
CLK_a_Smoe       ------------------------------------------W-----------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         --------------------------------A-EAP--SPP------------------
CLK4_Mmus        --------------------------------QFKDS--DCH------------------
CLK3_Mmus        --------------------------------R-REP--PPR------------------
CLK2_Mmus        --------------------------------R-RRE--DSY------------------
CLK1_Mmus        --------------------------------S-KTT--DSY------------------
E02H4.3_Cele     ------------------------------------I--GSP------------------
C16A11.3_Cele    --------------------------------P-PEP--TPAPKIERKTTKVLYIQRFLD
KNS1_Scer        ---------------------------------------------RPRQHQHQLFLDNEN
CLK4_Hsap        --------------------------------QFKES--DCH------------------
CLK3_Hsap        --------------------------------R-REP--PPR------------------
CLK2_Hsap        --------------------------------R-RRE--DSY------------------
CLK1_Hsap        --------------------------------S-KMC--DSH------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        FDNNNYNTQNLGDYSYKNDGYNNDNNNNDNNNSYGDTDREKY------------------
22369_Tthe       ---------------------------------RRNN--SPR------------------
CLK_Spur         --------------------------------H-HHP--KAG------------------
CC1G_01467_Ccin  --------------------------------S-TLP--SLR------------------
CC1G_10232_Ccin  --------------------------------P-PDP--STGLDVFVRIAGAIAL-GRHL
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  --------------------------------EVKEL--DSD---G--------------
AqueK109_Aque    --------------------------------Q-PLP--SKD---A--------------
CLK_a_Smoe       ---------------------------------------------Q--------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         -----------------------RIT-NT----HHT----RSAA-------------KRR
CLK4_Mmus        -----------------------YLE-ARC------------LN-------------ERD
CLK3_Mmus        -----------------------RSR-SRS----HD----RIPY-------------QRR
CLK2_Mmus        -----------------------HVR-SRS---SYD----DHSS-------------DRR
CLK1_Mmus        -----------------------YLE-SRS------------IN-------------EKA
E02H4.3_Cele     -----------------------NVP-STS---QPQ----QGDN-------------EKR
C16A11.3_Cele    FLSDKS-ENIKSPLPLTKFFQDYKTK-SNCSQSLAT----AKKK--LLANLFEHIVMSAK
KNS1_Scer        AIELDEEP---------------RII-NTT------------IN-------------NSN
CLK4_Hsap        -----------------------YLE-ARS------------LN-------------ERD
CLK3_Hsap        -----------------------RSR-SRS----HD----RLPY-------------QRR
CLK2_Hsap        -----------------------HVR-SRS---SYD----DRSS-------------DRR
CLK1_Hsap        -----------------------YLE-SRS------------IN-------------EKD
Y111B2A.1_Cele   ------------------------------AYSSCG----EKLE-------------FR-
ClkA_Ddis        -----------------------SIE--KI---CNE-NDYDSV--------------NNN
22369_Tthe       -----------------------RNY-NR-----YD----NRNY-------------ERR
CLK_Spur         -----------------------TAE-TTT---VTG------------------------
CC1G_01467_Ccin  ------------------------HV----VLNSSS----DLLPIASRRDLF-SIVL-TD
CC1G_10232_Ccin  FEAGYVLGRFDVPAI---IQYRQFER----DVLGLS----GGTQIRQLMDTY-GIIA-WF
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  -----------------------KVREVIV---IEDTPPPPTLS-------------PAT
AqueK109_Aque    -----------------------ILP-SSS---SSS----SSS-----------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     ------------------------------------------------------------
C16A11.3_Cele    YNDDRKAEM-LFAIGLRVEDEFLERLRGRATVEVDDCQRITFYKSKTSTSSPETVSFVLA
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        ------------------------------------------------------------
22369_Tthe       ------------------------------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  FMDGRAVDYLAHSLHFDVNRTHLTSLRIRIKAGLDLSQTV-LPTLQENLPKL--------
CC1G_10232_Ccin  PF----------------------------------------KKLVVRLGRR--------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         -----------------------------------------------RHE-LD--AKKAQ
CLK4_Mmus        -----------------------------------------------YRDRRY--IDEYR
CLK3_Mmus        -----------------------------------------------YREHRD--SDTYR
CLK2_Mmus        -----------------------------------------------LYDRRY--CGSYR
CLK1_Mmus        -----------------------------------------------YHSRRY--VDEYR
E02H4.3_Cele     -----------------------------------------------LIEKKL--SL--R
C16A11.3_Cele    ATTAIAEAH-----------------------LSD---ASVIDGISAIEFFKY--IENYA
KNS1_Scer        -----------------------------------------------NHNSSR--VDEDA
CLK4_Hsap        -----------------------------------------------YRDRRY--VDEYR
CLK3_Hsap        -----------------------------------------------YRERRD--SDTYR
CLK2_Hsap        -----------------------------------------------VYDRRY--CGSYR
CLK1_Hsap        -----------------------------------------------YHSRRY--IDEYR
Y111B2A.1_Cele   ---------------------------------------------------RF-------
ClkA_Ddis        -----------------------------------------------NNNRNY--SNSYN
22369_Tthe       -----------------------------------------------DSQSRR--TDKYQ
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ETLSVEQPKLNAKEVLTALATNSGWFTEMQCFALNPSAGV-LYER------KKYGI----
CC1G_10232_Ccin  EVVRVSLA-ITNVNPIDFVINNSGCTAMMQI----ITPRR--------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  -----------------------------------------------THNGGY--SASYQ
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         IS-KE-------P------------TF---------------------------------
CLK4_Mmus        -NDYC-------E------------GY---------------------------------
CLK3_Mmus        CEERS-------P------------SF---------------------------------
CLK2_Mmus        RNDYS-------R------------DR---------------------------------
CLK1_Mmus        -NDYM--------------------GY---------------------------------
E02H4.3_Cele     KKKLS---GEGVP------------PA---------------------------------
C16A11.3_Cele    -KDKA-------LLSLCDDLQQKIQGL---------------------------------
KNS1_Scer        -DDDIIFIKEQPI------------QF---------------------------------
CLK4_Hsap        -NDYC-------E------------GY---------------------------------
CLK3_Hsap        CEERS-------P------------SF---------------------------------
CLK2_Hsap        RNDYS-------R------------DR---------------------------------
CLK1_Hsap        -NDYT-------Q------------GC---------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NNNYN-------D------------GNNNYNSNNYNYNNNNNNNNNINNNNNSNSNSNSN
22369_Tthe       NLD---------------------------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  PPALA-------P------------IR---------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     ------------------------------------------------------------
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ------------------------------------------------------------
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        SNSNSNSNSNSNSNNNNYNNYGYNNHKSNNGGNRYSDDDDNVFNNNNNNNNNNNNNYNNY
22369_Tthe       ------------------------------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ----------------D-----DS---IST------------------------------
CLK4_Mmus        ----------------V-----PR---HYH------------------------------
CLK3_Mmus        ----------------G-----ED---CYG------------------------------
CLK2_Mmus        ----------------G-----EA---YYD------------------------------
CLK1_Mmus        ----------------E-----PG---HPY------------------------------
E02H4.3_Cele     ----------------G-----SM---LTGSKSGVE---------------------IGL
C16A11.3_Cele    ----------------EA-----MDKKIQY------------------------------
KNS1_Scer        ----------------SSPLILPS---S----SSINNNNNIVTSNNPGCGTAATSNST--
CLK4_Hsap        ----------------V-----PR---HYH------------------------------
CLK3_Hsap        ----------------G-----ED---YYG------------------------------
CLK2_Hsap        ----------------G-----DA---YYD------------------------------
CLK1_Hsap        ----------------E-----PG---HRQ------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NSNNNYNNDYDYNDGKR-----AN---IYS------------------------------
22369_Tthe       ----------------------RK---YHH------------------------------
CLK_Spur         ----------------G-----EV---TTT------------------------------
CC1G_01467_Ccin  --------------------------QYHY------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ---------------------------TRA------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ---------------------VPK---T--------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ----------------------PV---T--------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         -------R--------R-------------------------------R--KER--SKRS
CLK4_Mmus        -------R--------D-------------------------------V--EST--YRIH
CLK3_Mmus        -------S--------S-------------------------------R--SRH--RRRS
CLK2_Mmus        -------T--------D-------------------------------F--RQS--YEYH
CLK1_Mmus        -------G--------E-------------------------------P--GSR--YQMH
E02H4.3_Cele     SSNLTTTN--------N-------------------------------N--NNK--EQTD
C16A11.3_Cele    -------NVLSRVFQAT-------------------------------ISLRKTVQ--KL
KNS1_Scer        ---YI------------------------------------------------T--TPKK
CLK4_Hsap        -------R--------D-------------------------------I--ESG--YRIH
CLK3_Hsap        -------P--------S-------------------------------R--SRH--RRRS
CLK2_Hsap        -------T--------D-------------------------------Y--RHS--YEYQ
CLK1_Hsap        -------R--------D-------------------------------H--ESR--YQNH
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        -------R--------NNSNNNNNSKSGNNNSNNYNHNNSNNNGGYNNY--NNG--YNNY
22369_Tthe       -------S--------D-------------------------------R--SN----KFQ
CLK_Spur         -------I--------I-------------------------------T--SEM--TS--
CC1G_01467_Ccin  -------RELRWLFDEI--------------------------------SASRKFL--KA
CC1G_10232_Ccin  ---------SISIFPAH--------------------------------TFIKRVSFLLH
CC1G_15475_Ccin  -------------------------------------------------LIERRF-----
CC1G_06417_Ccin  -------R--------A-------------------------------A--AEA--QAMS
AqueK109_Aque    ---------------------------------------------------SKK--KPRG
CLK_a_Smoe       -----------------------------------------------------T--YPIS
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       -----------------------------------------------------G------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         -H----------------------R--------------KSP-----------------A
CLK4_Mmus        -C----------------------S--------------KSS-----------------V
CLK3_Mmus        -R----------------------E--------------RAP-----------------Y
CLK2_Mmus        -R----------------------E--------------NSS-----------------Y
CLK1_Mmus        -S----------------------S--------------KSS-----------------G
E02H4.3_Cele     -E----------------------Q--------------RAK--------KTVNAVAAAF
C16A11.3_Cele    -TKCGEMSKNGNLMARKFKNQQFFS--------------KMF-----------------V
KNS1_Scer        FK----------------------KQRTISLPQLPLSKLSYQSNYFNVPDQTNAIVPRVT
CLK4_Hsap        -C----------------------S--------------KSS-----------------V
CLK3_Hsap        -R----------------------E--------------RGP-----------------Y
CLK2_Hsap        -R----------------------E--------------NSS-----------------Y
CLK1_Hsap        -S----------------------S--------------KSS-----------------G
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        -N----------------------N--------------NNS-----------------N
22369_Tthe       KA----------------------N--------------KSY-----------------Y
CLK_Spur         ---------------------------------------GTK-----------------A
CC1G_01467_Ccin  -M----------------------------------------------------------
CC1G_10232_Ccin  -T----------------------D--------------KDA-----------------V
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  -S----------------------S--------------SSS-----------------V
AqueK109_Aque    -F----------------------K--------------MVV-----------------G
CLK_a_Smoe       -K----------------------K--------------GSET-----------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         AS------------------------------RR--------------------------
CLK4_Mmus        RS------------------------------RR--------------------------
CLK3_Mmus        RT------------------------------RK--------------------------
CLK2_Mmus        RS------------------------------QR--------------------------
CLK1_Mmus        RS------------------------------GR--------------------------
E02H4.3_Cele     ST------------QAGSGNATTVDDPASTTTSK--------------------------
C16A11.3_Cele    FP------------------------------LK--------------------------
KNS1_Scer        QTENELLHLTGSCAKTLEGNKAVNLTIAHS------------------------------
CLK4_Hsap        RS------------------------------RR--------------------------
CLK3_Hsap        RT------------------------------RK--------------------------
CLK2_Hsap        RS------------------------------QR--------------------------
CLK1_Hsap        RS------------------------------GR--------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NS------------------------------NHNSSYNNNNNNNYNNNNNNNNNNNNNN
22369_Tthe       NS------------------------------NR--------------------------
CLK_Spur         RT------------------------------EN--------------------------
CC1G_01467_Ccin  --------------------------------SI--------------------------
CC1G_10232_Ccin  KC------------------------------AI--------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  LT------------------------------AP--------------------------
AqueK109_Aque    SS------------------------------KK--------------------------
CLK_a_Smoe       ----------------TL------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         ------------------------------------------------------------
CLK4_Mmus        ------------------------------------------------------------
CLK3_Mmus        ------------------------------------------------------------
CLK2_Mmus        ------------------------------------------------------------
CLK1_Mmus        ------------------------------------------------------------
E02H4.3_Cele     ----------------------------------------------------------EN
C16A11.3_Cele    ------------------------------------------------------------
KNS1_Scer        ----------------------------------------------------------TS
CLK4_Hsap        ------------------------------------------------------------
CLK3_Hsap        ------------------------------------------------------------
CLK2_Hsap        ------------------------------------------------------------
CLK1_Hsap        ------------------------------------------------------------
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNISNNSNNNNFNYNNDNDRNNSNG
22369_Tthe       ------------------------------------------------------------
CLK_Spur         ------------------------------------------------------------
CC1G_01467_Ccin  ------------------------------------------------------------
CC1G_10232_Ccin  ------------------------------------------------------------
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  ------------------------------------------------------------
AqueK109_Aque    ------------------------------------------------------------
CLK_a_Smoe       ------------------------------------------------------------
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         --------------QHKYRYRDETSH--------S--------------SSR-------R
CLK4_Mmus        -------------------------------------------------SSP-------K
CLK3_Mmus        -------------------------------------------------HAH-------H
CLK2_Mmus        -------------------------------------------------SSR-------R
CLK1_Mmus        -------------------------------------------------SSY-------K
E02H4.3_Cele     PAAQPPKPKSAAVQNLISQLQLPASV--------S--------------AKVDKIIACGD
C16A11.3_Cele    -------------------------------------------------KTF-------K
KNS1_Scer        PFSNPPAQ-IASL-------P-------------Q--------------SNL-------K
CLK4_Hsap        -------------------------------------------------SSP-------K
CLK3_Hsap        -------------------------------------------------HAH-------H
CLK2_Hsap        -------------------------------------------------SSR-------R
CLK1_Hsap        -------------------------------------------------SSY-------K
Y111B2A.1_Cele   ------------------------------------------------------------
ClkA_Ddis        NYNNNSSN-I-----------NNNNNNNNNSNSYHNSCISYSNGGSNSKNSN-------K
22369_Tthe       -------------------------------------------------SNS-------I
CLK_Spur         -------------------------------------------------ATV-------G
CC1G_01467_Ccin  -------------------------------------------------G---------T
CC1G_10232_Ccin  -------------------------------------------------SMH-------E
CC1G_15475_Ccin  ------------------------------------------------------------
CC1G_06417_Ccin  -------------------------------------------------APK-------K
AqueK109_Aque    --------------QS---VKDKESH--------Q-------------------------
CLK_a_Smoe       --------------------S-------------N--------------FS--------K
CLK_d_Smoe       ------------------------------------------------------------
CLK_b_Smoe       ------------------------------------------------------------
CLK_c_Smoe       ------------------------------------------------------------
GK028_Glam       ------------------------------------------------------------


Doa_Dmel         R----------------------------HR----------DRAKD--------------
CLK4_Mmus        R----------------------------------------KRNRP--------------
CLK3_Mmus        C----------------------------HK----------RRTRS--------------
CLK2_Mmus        K----------------------------HR----------RRRRR--------------
CLK1_Mmus        S----------------------------K-----------HRSRH--------------
E02H4.3_Cele     K----------------------------AR----------KPSRS--------------
C16A11.3_Cele    F----------------------------QM----------KRTRA--------------
KNS1_Scer        K----------------------------------------QIGSS--------------
CLK4_Hsap        R----------------------------------------KRNRH--------------
CLK3_Hsap        C----------------------------HK----------RRTRS--------------
CLK2_Hsap        K----------------------------HR----------RRRR