Protein (view, download) , Domain (view, download)
11466_Tthe      MEQISQN--Q--------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      MDNIEV------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      MKEN--------------------------------------------------------
14173_Tthe      MNIISQN--L--------------------------------------------------
14925_Tthe      MDDKFEA--Q----------------------------------------------Q---
16201_Tthe      MGNNNQI--NKGSNQL--------------------------------------------
17306_Tthe      MSFESLQ--V--------------------------------------------------
17307_Tthe      MRFESLQ--V--------------------------------------------------
18245_Tthe      MQQQQSQ--YWIQQP---------------------------------------------
19406_Tthe      MNNNSSS--NQGSNQL--------------------------------------------
19991_Tthe      M-----------------------------------------------------------
19995_Tthe      MPNLVN------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      MKKQTKP--I----------------------------------------------HYLL
21480_Tthe      MDIIRQN--L--------------------------------------------------
21673_Tthe      MDFISQN--L--------------------------------------------------
21676_Tthe      MDIISQN--L--------------------------------------------------
21728_Tthe      MDTIRQN--I--------------------------------------------------
21795_Tthe      MNQIQTIEDLKLNQEEFFILSNKNYRSCPRHPDNWIVSLSTNPSSTQFLQCAECFSENPN
22155_Tthe      MNTISQN--L--------------------------------------------------
22632_Tthe      MGCNQ-S--IKKQ-----------------------------------------------
22799_Tthe      MDIMSQN--L--------------------------------------------------
24183_Tthe      MEQISQN--Q--------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      M-----------------------------------------------------------
26374_Tthe      METISQN--L--------------------------------------------------
26388_Tthe      MGSTNQK--L--------------------------------------------------
27530_Tthe      MENIIQT--N--------------------------------------------------
27656_Tthe      MDIISQN--F--------------------------------------------------
28253_Tthe      MEQISQN--Q--------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      METISQN--L--------------------------------------------------
29587_Tthe      MNKISQN--L--------------------------------------------------
29589_Tthe      MNKISQN--L--------------------------------------------------
3066_Tthe       MDTISQN--L--------------------------------------------------
4498_Tthe       MDIISQN--T--------------------------------------------------
4501_Tthe       MDKISQN--P--------------------------------------------------
5174_Tthe       M-----------------------------------------------------------
5844_Tthe       MDTISQN--L--------------------------------------------------
6993_Tthe       MNNNSSS--NQGSNQL--------------------------------------------
9595_Tthe       MDIISQN--L--------------------------------------------------
23282_Tthe      MQVQSQP--K--------------------------------------------------
6536_Tthe       MYNLNQE--D--------------------------------------------------
n1168_Tthe      MEQISQN--Q--------------------------------------------------
n1058_Tthe      MNKISQN--L--------------------------------------------------
n1175_Tthe      QINKF-------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      MDIISQN--L--------------------------------------------------
n1205_Tthe      MNNNSSS--NQGSNQL--------------------------------------------
n1201_Tthe      MDIISQN--L--------------------------------------------------
n1203_Tthe      MDTISQN--L--------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      ----QLNRLQEN----------------------------------QY------------
16201_Tthe      -----GMQQ---------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      -----RMQQ---------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      LFAAYFFCRQEA----------------------------------TNR--QIDRQID--
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      QQTLNLVGLIKENEKTIFKNYPIYGENHIYEKLKQIFKADCSIDGLKSKISSFFLNLRKQ
22155_Tthe      ------------------------------------------------------------
22632_Tthe      --------Q---------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       -----RMQQ---------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      -----RMQQ---------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      -----------QSYQDRVNMFQQNNKILEQVRSHFKHPEQYEGDHLGGDLAWQNEYYKLY
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      -------KQINM------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      IEQKINHKEEQM------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      NDRLQKQFEDLLTGKGFSVYQKDLIIKPVSGNQFEELLISSDRLSPLLKALEDENKILKE
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      EVSHLSGDLKRFIGMVELLLEENKYIREHINQKNRDITKLIETIGLNDGEEINDLKHKIH
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      ILTEENNILIKHLDEMKRFREEYDNFVYENDQEINRAREVIEKTKDDLEEALKREESLTK
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      QLAQIEPKFTKYSQKVAELEEQVEELQNKLNHAKNDNQTLKSEYLHYKRQLAFKVQMINY
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      ILLINQSHYEDLSRKRGDENDQLLQENNMLMNEKKEFKQQLLFKDRQIEELKQQVLSFRK
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      DVETKGYDLDELSQAVNEFKNQIQVEKQRAESALQRERQMREQFEIIQSESQKNQIKCEQ
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      LERQYNSLLESSRQELQDKHIKYEGLIEKQKIKNREEMDSKDEEITDLKTKIVEKDRIIQ
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      QLNNELERRNSDVNDFKKKLQDLKESRNLLDRQAQELIQLKNENRDLHNNLLELKNSKAS
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      FSGGEKEYKQMLNQIREFEISISQLEKNNTLLKEENDHLKMQVQDQKQEVREFQEKLALS
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      KKEIQQLKDERDEMMQKQMEEVSFFILIKPVYLAKFQIIFNKITRESIKWVGMIKALNQD
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      ------------------------------------------------------------
24609_Tthe      ------------------------------------------------------------
25184_Tthe      ------------------------------------------------------------
26374_Tthe      ------------------------------------------------------------
26388_Tthe      ------------------------------------------------------------
27530_Tthe      ------------------------------------------------------------
27656_Tthe      ------------------------------------------------------------
28253_Tthe      ------------------------------------------------------------
29096_Tthe      ------------------------------------------------------------
29524_Tthe      ------------------------------------------------------------
29587_Tthe      ------------------------------------------------------------
29589_Tthe      ------------------------------------------------------------
3066_Tthe       ------------------------------------------------------------
4498_Tthe       ------------------------------------------------------------
4501_Tthe       ------------------------------------------------------------
5174_Tthe       ------------------------------------------------------------
5844_Tthe       ------------------------------------------------------------
6993_Tthe       ------------------------------------------------------------
9595_Tthe       ------------------------------------------------------------
23282_Tthe      ------------------------------------------------------------
6536_Tthe       ------------------------------------------------------------
n1168_Tthe      ------------------------------------------------------------
n1058_Tthe      ------------------------------------------------------------
n1175_Tthe      ------------------------------------------------------------
n1215_Tthe      ------------------------------------------------------------
n1194_Tthe      ------------------------------------------------------------
n1205_Tthe      ------------------------------------------------------------
n1201_Tthe      ------------------------------------------------------------
n1203_Tthe      ------------------------------------------------------------


11466_Tthe      ------------------------------------------------------------
12644_Tthe      ------------------------------------------------------------
13106_Tthe      ------------------------------------------------------------
13633_Tthe      ------------------------------------------------------------
13816_Tthe      ------------------------------------------------------------
14173_Tthe      ------------------------------------------------------------
14925_Tthe      RINLILTAVKVEMQVHWIINLICNTNEPNQPTKINQIKIKTKIKIDINIIINQLIIKQDQ
16201_Tthe      ------------------------------------------------------------
17306_Tthe      ------------------------------------------------------------
17307_Tthe      ------------------------------------------------------------
18245_Tthe      ------------------------------------------------------------
19406_Tthe      ------------------------------------------------------------
19991_Tthe      ------------------------------------------------------------
19995_Tthe      ------------------------------------------------------------
20038_Tthe      ------------------------------------------------------------
20891_Tthe      ------------------------------------------------------------
21480_Tthe      ------------------------------------------------------------
21673_Tthe      ------------------------------------------------------------
21676_Tthe      ------------------------------------------------------------
21728_Tthe      ------------------------------------------------------------
21795_Tthe      ------------------------------------------------------------
22155_Tthe      ------------------------------------------------------------
22632_Tthe      ------------------------------------------------------------
22799_Tthe      ------------------------------------------------------------
24183_Tthe      -------------