Protein (view, download) , Domain (view, download)
14484_Tthe      MEL---------------------------------------------------------
10501_Tthe      MIV---------------------------------------------------------
14485_Tthe      MEL---------------------------------------------------------
14879_Tthe      MSKNNQN------------------KQKLYSDQQQGQNR---------------------
18715_Tthe      MSELDQC-----------------------Q-----------------------------
23558_Tthe      MQIFVII-----------------------L-----------------------------
26506_Tthe      MIEDQ-------------------------------------------------------
26507_Tthe      MIEDQ-------------------------------------------------------
4866_Tthe       MAIKVILTKDQYAALKFCGCDFEDHLNTFETKKIMNLKLFEEQKRGDQTNQINQKINGNI
6544_Tthe       MEN---------------------------------------------------------
9395_Tthe       MQE---------------------------------------------------------
n1191_Tthe      MLHQTFI-----------------------LNT---------------------------
                *

14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      --------NE--------------------------------------------QIPYQP
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       YDNKQGMQNEQISHNQYQSPQKKEDISIINHKQILSNKNISLNLPGNQSTEACKNILQED
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ----------------------------------------------------II-K--Q-
10501_Tthe      ----------------------------------------------------DL-RNCD-
14485_Tthe      ----------------------------------------------------II-K--Q-
14879_Tthe      I-----------S---FKQ---------------------------------LA-N--Q-
18715_Tthe      -----------QKIDRFLQNNNFKQAINYVTSLKQSGMSPENVSYLQVYISKKMNQ--Q-
23558_Tthe      -------IIILIYIKFMSS---------------------------------VL-K--Q-
26506_Tthe      ---------VDQY---VSK---------------------------------VV-Q--Q-
26507_Tthe      ---------VDQY---VSQ---------------------------------VV-Q--Q-
4866_Tthe       FIFKRLENQNSNY---IDE---------------------------------TI-K--QE
6544_Tthe       ----------------------------------------------------FS-FISQ-
9395_Tthe       ----------------------------------------------------LF-S--C-
n1191_Tthe      -------SQNQSH---IKI---------------------------------IE-K--D-


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       TKSYDSPLLNFNYKQQDNDESKQLFESKGDNKIQELQLVEQNKIKIQKQAQHFKLNFTES
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ----------------LET-----------------------------------------
10501_Tthe      ----------------HPN-----------------------------------------
14485_Tthe      ----------------LEI-----------------------------------------
14879_Tthe      ----------------LEK-----------------------------------------
18715_Tthe      ----------------LNKNIQEPKKKLSLKTESNQDAFSPRYLQNKSTKFESQSQLFQS
23558_Tthe      ----------------IAS-----------------------------------------
26506_Tthe      ----------------LNQ-----------------------------------------
26507_Tthe      ----------------LNQ-----------------------------------------
4866_Tthe       YIRSRDQDFKGDDGLQIFE-----------------------------------------
6544_Tthe       ----------------FSS-----------------------------------------
9395_Tthe       ----------------LKQ-----------------------------------------
n1191_Tthe      ----------------LLK-----------------------------------------


14484_Tthe      ----------------------------H-----KQIK------------VTKSYI----
10501_Tthe      ----------------------------I-----LKY--------------FDSFIIQN-
14485_Tthe      ----------------------------H-----KQIT------------VTKSYI----
14879_Tthe      ----------------------------E-----KFLR------------ILDNLV----
18715_Tthe      ESRNPPSVKRQNNYPKLDNNCFSSTLSKFDDLNSQMTKRQSIKEGNQKQLMDSLKV----
23558_Tthe      ----------------------------L-----KGIQ------------FQSYKQ----
26506_Tthe      ----------------------------I-----KDLE------------VTDIRK----
26507_Tthe      ----------------------------I-----KDLE------------VTDIRK----
4866_Tthe       ----------------------------I-----EDIE------------IQNSQK----
6544_Tthe       ----------------------------A-----KQV--------------FDHYQAKND
9395_Tthe       ----------------------------N-----LGLI------------VLQEKA----
n1191_Tthe      ----------------------------F-----QNIQ------------IIDSKK----
                                                                    .

14484_Tthe      ------------------------------------------------------------
10501_Tthe      YHFILLEGVERSLYDVVLQHSGSDQFN--QSYFNITIQLLKGLDYLH------------S
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       --------------------------------------------------KE--------
6544_Tthe       QNQLDDSQTLNISKHNNP----EDQVDLEQNILEKAQQLFNQNDYKTAQIYFNQIVQEDS
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ----------------DNP-GQQYTVIA----N-DNQNQ---------------------
10501_Tthe      KNL-FLHIPTLKSIFVDKN-MNVKFLYF----Q-TQQNS---------------------
14485_Tthe      ----------------DKP-DQQYTVIA----H-DSQNQ---------------------
14879_Tthe      ----------------DLNNNMNKILLAQ---HKIKDTQ---------------------
18715_Tthe      ----------------NK-SV-VKLPSLN-----SLE-NEKYNQLKQIVKESLKDLNGKI
23558_Tthe      ----------------NK-KD-QRVFFLN-----SQN-E---------------------
26506_Tthe      ----------------DKE-GFGKYLFAK---Y--QQNS---------------------
26507_Tthe      ----------------DKE-GFGKYLFAK---Y--QQNS---------------------
4866_Tthe       ----------------NKN-KPSKKIFLENLKK--AENQ---------------------
6544_Tthe       KNVQAIQNLALCNFYL-KN-YD--------------EGI---------------------
9395_Tthe       ----------------DRI-NREDILFVQ---N-ENQEE---------------------
n1191_Tthe      ----------------YE-EGLSDIVYIK-----QSNFQY--------------------
                                                    :

14484_Tthe      ------------------------------------------------------------
10501_Tthe      --------------DKN-ELTTILSYFDHYKLPFIPPEDFILENDQQEIHYKENLTVEGN
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      NQKYFKSNALLDQAN-----------------FYNKQKEFDKAIEYYDQAMEVDTNNINI
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       --------------LLMQKAIEMQPDYIDKLYYYLGCAYCDQ------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      IWSICMCLYEMAGASYLQQKQFALAQQWIDQIKESQQSEAEIEMFAEVQKEFDNQKYLEA
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      LVG-------------------------------------------KGDCLRKQGQYEAA
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------KHYMQG
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      LNILQKLLQSNQCIDKYLA---WIGRCYCAI-----------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      LECYEYGMNLNPPHKYQFRILFNKGNIYKCM-----------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------SKVTTKQ---V-AKKFQANHVNHIQELNKLDKDVFLQNLHEQIRTTSK
6544_Tthe       LVYLEKAMTQNQNNQDAIF---MLGNTYQNI-----------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ----------------NQLDESEYWSSQSLKINPNNDISYFNLGNIWKIRKNFEKAINFF
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ----------------GKNKEAIECYSKASLLDPQNPNTYFNKALAFYSLGELDEVIDNY
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       GRQKIYNLLSLGVSKLEC-----------L------------------------------
6544_Tthe       ----------------SC-----------LQIAQ--------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      QRSIDCNPKNIYS-----------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      SRVVKQNPRDQHALLNKGMALREIGEFGPAVECFVKASEMKARNARQYLNKGNALFQIDK
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ----------N-------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ----------------------------------------Y-------------------
10501_Tthe      ---------------------MNNLGLIYDSQSMEAQAQQM-------------------
14485_Tthe      ----------------------------------------Y-------------------
14879_Tthe      ----------------------------------------Y-------------------
18715_Tthe      LEDALICYKKAIMIENNFYEAFLNMGVVLNELGRTVEEIECYKKVLELKPDDVKALYNQA
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ----------------------------------------C-------------------
26507_Tthe      ----------------------------------------C-------------------
4866_Tthe       ----------------------------------------Y-------------------
6544_Tthe       ----------------------------------------Y-------------------
9395_Tthe       ----------------------------------------Y-------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      --------------------------------SIKVI-----------------SL--HQ
10501_Tthe      --------------------------------YLRAIEIQPEKQFLYYNMGRSFYL--QS
14485_Tthe      --------------------------------SIKVI-----------------SL--HQ
14879_Tthe      --------------------------------SVRII-----------------SL--FD
18715_Tthe      VALRELGEVEESAKQFDKVIKINPKMVNAYINKGLSQ-----------------YI--LG
23558_Tthe      ------------------------------------------------------------
26506_Tthe      --------------------------------MIKII-----------------SI--QS
26507_Tthe      --------------------------------MIQII-----------------SV--QN
4866_Tthe       --------------------------------NQRSL-----------------QLSVNS
6544_Tthe       --------------------------------YKKLI-----------------EI--DS
9395_Tthe       --------------------------------VMRIF-----------------NL--QS
n1191_Tthe      --------------------------------LLKII-----------------NL--QS


14484_Tthe      NDG---------------------------------------------------------
10501_Tthe      NYEEAKKWFLKTLDIDPTYHKSLTYLGEIEFIQNNHQEAMVYFHKSLKVSPNE-NTYFSL
14485_Tthe      NQD---------------------------------------------------------
14879_Tthe      GS----------------------------------------------------------
18715_Tthe      QFKESYDSYKEALKIDNNSIESYINMSQCLRQMKKSNKALKLLMKALKISPNNFELYFQI
23558_Tthe      ------------------------------------------------------------
26506_Tthe      D-----------------------------------------------------------
26507_Tthe      D-----------------------------------------------------------
4866_Tthe       T-----------------------------------------------------------
6544_Tthe       SNQ---------------------------------------------------------
9395_Tthe       DDD---------------------------------------------------------
n1191_Tthe      DFEE--------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      GTQYY-------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      GEIYKQILNIKKALEYYSYSIQLNPIYSEAIFQKGVCLSIINELESANKCFDLCIKFNPS
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ----------------------------------KN--EIR-------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      NPKPHINKGQIYEVQGKLKSALRQYDMAVTLKNGQESDDLALLCKAHAYRERVGEESKLN
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      AIEIYNFLIDRKSSNPNTKFYAYLGYSAIIIKEIIVNNLQALGRFSPITDSYQSSQVSSL
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ---------E-QMS-QQKLEYA------KQLALSLKSCNHENIAKYLGEFQIQENYF--I
10501_Tthe      ---------QVKKR-SNKIKKL------EEMIVDLRNCDHPNILKYFDSFIIQNYHF--I
14485_Tthe      ---------E-QIS-QQRLDYA------QQLAHSLKSCNHENIAKYFGEFQIEENYF--I
14879_Tthe      ---------D-QIS-SQMLEIA------INEADFLKNSNHPNIVCYIDSFQIDFYYF--I
18715_Tthe      AQISQVQLNQQTQQ-SQFIQIN------LKTEND-TDRKQQKLIQTLSGAEIEDAYF--H
23558_Tthe      ----------------------------------------------------GHGYT--V
26506_Tthe      ---------E-QLSQQKKLQKA------MEKVNRLKQCSHKNILRYYDSFQIEDSFF--I
26507_Tthe      ---------E-KLSQYKKLQIA------IEKVNRLKQCSHKNIIRYYDSFQIEDSFF--I
4866_Tthe       ---------E-DVR-PEKLEEV------NRMIQMLKNSNNSNILQYLDSFQIENYCF--I
6544_Tthe       -----------KAH-FQMGETHFKMQNYKDASEAYKKACKINPENYYFYLKLGTSQYKEQ
9395_Tthe       ---------QSKIC-DQKLNQA------QNFAKLLQECNHENIPKYIDQFQIKQFYL--I
n1191_Tthe      ---------LGVVC-QNKLADA------QKLAKDISESLHENIIKCISHFQIQHFYL--V


14484_Tthe      L-----------------------------------------------------------
10501_Tthe      L-----------------------------------------------------------
14485_Tthe      L-----------------------------------------------------------
14879_Tthe      V-----------------------------------------------------------
18715_Tthe      LFCLLASEIERMTTFTSPDIQKIQDEQKQDFTLILLLRYLNLKKKQGVNYLGMGNAKHII
23558_Tthe      L-----------------------------------------------------------
26506_Tthe      V-----------------------------------------------------------
26507_Tthe      V-----------------------------------------------------------
4866_Tthe       Q-----------------------------------------------------------
6544_Tthe       N-----------------------------------------------------------
9395_Tthe       L-----------------------------------------------------------
n1191_Tthe      Q-----------------------------------------------------------


14484_Tthe      --------------------------------------------------------LESF
10501_Tthe      --------------------------------------------------------LESV
14485_Tthe      --------------------------------------------------------LERF
14879_Tthe      --------------------------------------------------------MEKC
18715_Tthe      YMVLSYIYIGLKKRERKEFDESILYFEFLMNLDKDLEIFCRYQSFISYLQSNYFQNNKKI
23558_Tthe      --------------------------------------------------------VED-
26506_Tthe      --------------------------------------------------------MEKV
26507_Tthe      --------------------------------------------------------MEKV
4866_Tthe       --------------------------------------------------------FERP
6544_Tthe       --------------------------------------------------------LEEA
9395_Tthe       --------------------------------------------------------MESF
n1191_Tthe      --------------------------------------------------------MEYC
                                                                         :

14484_Tthe      EMNLIDWQV---------------------------------------------------
10501_Tthe      ERSLYDVTL---------------------------------------------------
14485_Tthe      EMNLIDWQL---------------------------------------------------
14879_Tthe      EKSLQQLVE---------------------------------------------------
18715_Tthe      SFPLSEMIAKGSTSETYGISFDKNQINEHELSEEDTTKQQTQQQQQQQQIKLSNISKQLL
23558_Tthe      ------------------------------------------------------------
26506_Tthe      EFSLQQWIN---------------------------------------------------
26507_Tthe      EFSLQQWIN---------------------------------------------------
4866_Tthe       EKTIFDWIK---------------------------------------------------
6544_Tthe       LKSLQQAVV---------------------------------------------------
9395_Tthe       DTTLFNWSQ---------------------------------------------------
n1191_Tthe      GQTLQDWIL---------------------------------------------------


14484_Tthe      ----------------------------------QN------------------------
10501_Tthe      ----------------------------------QH------------------------
14485_Tthe      ----------------------------------KN------------------------
14879_Tthe      ----------------------------------QL------------------------
18715_Tthe      ENFEKELVCRKIKSTVFKTNKDQYYKQFAIQNILNHRNIQKINYMYFDHEENIYFIEPRQ
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ----------------------------------DN------------------------
26507_Tthe      ----------------------------------DN------------------------
4866_Tthe       ----------------------------------EK------------------------
6544_Tthe       ----------------------------------LN------------------------
9395_Tthe       ----------------------------------QV------------------------
n1191_Tthe      ----------------------------------EN------------------------


14484_Tthe      --------KLN-KKIN-RKTFIQFALQLFHALEHIHSKNYVLQKLA-----------LRN
10501_Tthe      --------SDS-D-QF-NQSYVSITIQLLKGLDYLHSKNLFLHIPT-----------LKS
14485_Tthe      --------KLK-KQID-RKIFIQFSLQLLHALEHIHSKNYVLQELA-----------LRN
14879_Tthe      --------TNTQIQIS-DDLYFNIACQTLSAIDYLHKQKYRLEELS-----------LKT
18715_Tthe      KYNLEAHLHQY--IVS-FEQRLNILLQISQAVQYLHSNGIVHGNIS-----------MKN
23558_Tthe      ---------LG--DID-DNVFIDFALQLLNAVEYLHSKNLYLSNFS-----------NEN
26506_Tthe      --------RRNL--IQ-KEQFLKFAQQMVEVADYLHHQKYILSNIS-----------LKN
26507_Tthe      --------KKNL--IQ-KEQFLKFALQMVEAADYLHQKKYILSNIS-----------LKN
4866_Tthe       --------KDDA-IIESNDYLFKVCAQIANAMSYLHKYNCFLMDMS-----------PEY
6544_Tthe       --------NKF-A-KI-GSIFYKLIEALVEQNHLEKCIQYYLKMFALNPKNASSYFVLGD
9395_Tthe       --------ENF-YYIK-NDLFIKFSQELFSIVEYIHSKNYLLQNLT-----------LQN
n1191_Tthe      --------RRK--KID-RQTFIMLSKQILDAASFIHSKGLVLYNFA-----------PRN
                                  .    .           :         :

14484_Tthe      IYLDKDYNIKLSD-FGFPQEVIPSQLSRQFM-----------------------------
10501_Tthe      IFVDKNMNVKFLY-FQTQQNSDKNVLT-AIL-----------------------------
14485_Tthe      IFLDKDYNIKLCD-FGFPQEVIPSEISKQFM-----------------------------
14879_Tthe      ILIDRNNNVKLYN-FKKVKQDYISLLNQK-D-----------------------------
18715_Tthe      ILIRNSDFIPLLTGFRNSRIILSTYHSSSFQNIQQSNTKQPTLFFSANHNPNNFTSPDLT
23558_Tthe      IFLDENFNIKLHD-FGLRKSINTLQAYKLFQ-----------------------------
26506_Tthe      IFLDRDLNIKLST-FTVQQEVSVKYLLDKQI-----------------------------
26507_Tthe      IFLDRDLNIKLST-FTVQQEVSVKYLLHKQI-----------------------------
4866_Tthe       IFLNEHGNVKIFC-NKFVSSDEKDGIYKSYV-----------------------------
6544_Tthe       ICI-QEKQIQTAK-LFFEESVK--LDA-SFL-----------------------------
9395_Tthe       IYIDKNMKLKILD-FGEGQSIIPSIETKKFL-----------------------------
n1191_Tthe      IFLQ-NQNIKIQL-FGEAKEINPSNSTQFFD-----------------------------
                * :     :

14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ISLAEDIYALGQVFEKMLLKIDQQDRMINNWYKKGFTSSLSLQKLVRNMLEHNKVYKRPD
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ITRVVETLQFESIAAMLYNIYQGPFQSFAGMQSITSSASKNNSQVFSQIGGLNNQNLKNV
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      --------------------------------------DQKADNIQ-FYLPP--ELLD--
10501_Tthe      --------------------------------------SKFEDYKL-PFIPP--EDFI--
14485_Tthe      --------------------------------------DQRVDNIS-FYLPP--ELFD--
14879_Tthe      --------------------------------------NNITENTI-EPKPH--DLVE--
18715_Tthe      IHTHSLSGNNSGIATPANNNISTLTLLQQQQQQIQHQNIVDNNQYSHVQTPINSLPNNQN
23558_Tthe      --------------------------------------IGANQKGF-HYFAP--EQLN--
26506_Tthe      --------------------------------------YALENNQL-IYFPI--CLIE--
26507_Tthe      --------------------------------------YALENDQL-IYFPI--FLID--
4866_Tthe       --------------------------------------RSGRDGKY-FLYSP--EMLS--
6544_Tthe       --------------------------------------DGIKALGK-LYFET--NEFD--
9395_Tthe       --------------------------------------AQQPGNEY-IYLPP--EFFD--
n1191_Tthe      --------------------------------------MQIMQNIQ-FYLPP--EFLD--


14484_Tthe      -------------------ISKDKIAKQKKV-------------LQENEG----------
10501_Tthe      -------------------LENDQQEIHYKE-------------NLTVKG----------
14485_Tthe      -------------------FSKNKIAKQSKV-------------LQEKEG----------
14879_Tthe      -------------------DYCN----FAKIFLLLVQKVQFKNDYLSS-K----------
18715_Tthe      IKLSRKQIKKLVPYQIFASELE-----DIRQ-------------YYKQTMQLKVISMNDV
23558_Tthe      -------------------SSL-----ETYV-------------LQTAEA----------
26506_Tthe      -------------------EGGN----QNMV-------------ALSNKQ----------
26507_Tthe      -------------------KRDN----QDLI-------------TLSSKQ----------
4866_Tthe       -------------------QALNI--WDSGV-------------KRKEKY----------
6544_Tthe       -------------------QAIKVFEKGLLI-------------DQNEVD----------
9395_Tthe       -------------------YSKKHDQKNEQV-------------KWTQCA----------
n1191_Tthe      -------------------NSVDAESQSIQQ-------------IWNQQA----------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      NTILTEKMAKVLNFQYIYVQDLLNRDLFLNSLSDVNINFLVIIIKQIQDCSSNDQIKLIQ
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ------------------------------------------------------------
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------DIWVVSICLYALTGPT-----------------LQFIKKFTE
10501_Tthe      ------------------NIWSICMCLYEMAGAS-----------------YLQQKQFA-
14485_Tthe      ------------------DVWVACVCLYALAEAT-----------------LVFIKRLTK
14879_Tthe      ------------------EIKK-LDCLNSLRAI---------------------------
18715_Tthe      EFLNSIKERNKRLETENIYQYSQARLLYRLIGRS-----------------DPEKYRYKL
23558_Tthe      ------------------DIWSVGISLYLLAGSN-----------------LDHIYLLTR
26506_Tthe      ------------------DMYTIGLCLYCLTGVS-----------------YMEVLNYIQ
26507_Tthe      ------------------DMYTIGLCLYCLTGVS-----------------YMEVLNYIW
4866_Tthe       ------------------DVWALGIVMLILLGQS-----------------EAVSINLHQ
6544_Tthe       ------------------IIYDIGCCLFELDKIQ-EATEQFRKAFRLNTISYEDVDGSMV
9395_Tthe       ------------------DIWMLGICLYALAGAD-----------------LFQIQQFTQ
n1191_Tthe      ------------------DLWCIGMCLYSMAQAKNL---------------LYYLKELSY
                                          :  :

14484_Tthe      GSA-FY--IF--Y-------------------E--EIDQ---------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      GTG-FY--VF--Q-------------------E--KIDK---------------------
14879_Tthe      --T-FQ--GL--Q-------------------L--NQKN---------------------
18715_Tthe      M-Q-KL--QF--KDEYVNIASVFLSDGIEFIEN--SLRVYLLDSLPTLLFQLSKANLNNF
23558_Tthe      GLQ-QY--QK--Q-------------------M--QINE---------------------
26506_Tthe      GGK-FQ---V--N-------------------I--SLGV---------------------
26507_Tthe      GDK-FQ---V--S-------------------I--SLGV---------------------
4866_Tthe       QNCISS---VIES-------------------L--KIDQ---------------------
6544_Tthe       NKG-IQLQKS--K-------------------ENIKYSL---------------------
9395_Tthe       GKD-FF--QY--N-------------------L-NKVDL---------------------
n1191_Tthe      GTM-YY--QF--Q-------------------K--SIDI---------------------


14484_Tthe      --------------DI---------------------------NKVLM------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      --------------DI---------------------------NKVLM------------
14879_Tthe      --------------EI---------------------------QL-FI------------
18715_Tthe      TFPSSYSIQKKKLAIIEMFLEVISPLQISQNEIDKIAKDTGNHQKLLQ------------
23558_Tthe      --------------EM---------------------------NLLLS------------
26506_Tthe      --------------DI---------------------------NQLLQ------------
26507_Tthe      --------------DV---------------------------NQILQ------------
4866_Tthe       --------------SL---------------------------KCLLQ------------
6544_Tthe       --------------EY---------------------------FNFAILINSNNAEAFYQ
9395_Tthe       --------------EL---------------------------RKFVM------------
n1191_Tthe      --------------DI---------------------------NYILL------------


14484_Tthe      --NSFWLNT-SL-R----------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      --NSFWLNK-NL-R----------------------------------------------
14879_Tthe      --DFLFQNLALK-N----------------------------------------------
18715_Tthe      --ILKFDGY-LRSV----------------------------------------------
23558_Tthe      --QMLSQDP-NK-R----------------------------------------------
26506_Tthe      --LMLFRNTYSS-V----------------------------------------------
26507_Tthe      --LMLFRNQCSF-V----------------------------------------------
4866_Tthe       --NDIFNLNIQK-RLTVQELLSFFNQDQQVILKKSDSLSIVNQESIEKEVQLQDLNNEQQ
6544_Tthe       KGLLYECTC-NL-E----------------------------------------------
9395_Tthe       --NILCFNT-NQ-R----------------------------------------------
n1191_Tthe      --DFFQFDQ-IK-R----------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       DQSIEKTKSIDSDVKTQDEQEKHKEQHSRQTEKRRKRSSKKVEDSDGNEDEEEIEVEKGK
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       VARKDSKKKKLEKNQQKLVKKDAKDQSKDDKEIDEEKKDQVKINKNIFIDNKYLKKLMSK
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       SLSKAELVQETQNLKEHLEKQPNDIEALKVIAKLYQKRGMIDQEISHYKQIIELSPDDAD
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       VYFQLGKSYLGKSKEDEAVNCFNICFEKDNKHIDSIIKLGDYYLVQKQIKKAEDVVLKGL
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       QNRLEEALECFDLSLKFDHSNKQCTQDRLQTFKKIKEVEIVNCLKALEVDSLAYKDKDMY
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       DKAIESLDKSLSINPKQNLVYLALGDCFLLKNNIKFAKEKYYQSLEINPKCSLTWNQLGS
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       LYTLKKKYIKAIKAYLNSFHYSETKSPEQQVKICEIAKKQMDDCIKRFLKTTETADIHKI
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       KKVIQTYCFTKELEINNLKEQLSQEYAQSLKDMNSFYKFFHTLGLLYMAYKIPKKGILQL
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       QKSLILNQLNKACYIDLSAAFGTQNQKNQVIYYANQALFNYQTYKSNFLTYKEKRVLKSI
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       QQIKKIQIDEINNEISQDDLKSKAYYNIAHVLENKINLSIGYYNRSLKLDQKNAESYYRT
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       GILLFKQNMFENSIKSLNNCIKIDKYHLGAHEQLIQIYEVQQNKELEIYHKKTLKESKAF
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       KKYIYYMQNKDYEKCIQLLQEWEEINPTNDECQYYLSDLMRIIGKKDSQVHYLKQCLTLN
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       PTHELALQRKYELQNSCQNEQLAQTIFYEELDQHNNWEYVEQEENEFQNLLSIRSNSYIS
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       FKSGLYMKSKQDLSKAFLYFEEYSNQQPNDYLGFYLLGHIEEKNCNFEVAANFYLKSLQL
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       KPEDNFNSNNRLGIVYLNMKKVEEALKYLNEAKKIIHKEEINICAIAQCYSSLGQFKEAI
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ENYQICLQINPNNQLYEFFIFVINSRKLNLDDFFPEMKKKAVVVYEAYKNKNISSVMLHF
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       LECIINEKEHKNNCSGFCLYQLSKLSTQHKKIEEAVEHLKQSVRISPNYPPFRLAFAQNL
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       ISLLKYDKASEELEKILQQDSENYDANHFMGICQYQKNQFKSAIQYLSVCEAQKPNTYEI
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       IKLIGQCHKQMNQTEKAIQFFELCIDQNPKDAEVLILLAESLYKQGDVKQTLEMYQKAFK
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       YNTKDSQYFYQYAKILFETKDFNQAIIFAQECIKINSSLDNAQNLLGLCYMNIGDMNKAI
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       AAFKKQGQINRLHKDYLLNLGKAYIKKGQTVDAISTLSKFMNLYPDIEETYELLNYLFDL
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       QQQPKKQIKILQNLLEKYPKKTKLNLNIADIQYKQKLYQEAIESYEKYLKENEGSREIQY
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       RVAMCYVRKNLLKEANEILNKSIALYPDMIEYRYHLANVNLALGNYEESQKNIELLLEHN
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      ------------------------------------------------------------
23558_Tthe      ------------------------------------------------------------
26506_Tthe      ------------------------------------------------------------
26507_Tthe      ------------------------------------------------------------
4866_Tthe       PDHISGLFILAKLQFIQKDYKNALEKLEICLNTYDQIPELYYLLGCCYKKLGMKDLCLPC
6544_Tthe       ------------------------------------------------------------
9395_Tthe       ------------------------------------------------------------
n1191_Tthe      ------------------------------------------------------------


14484_Tthe      ------------------------------------------------------------
10501_Tthe      ------------------------------------------------------------
14485_Tthe      ------------------------------------------------------------
14879_Tthe      ------------------------------------------------------------
18715_Tthe      -------------------------------------------