Protein (view, download) , Domain (view, download)
CG1760_Dmel_DRAK    MIAA--------------------------------------------------------
DRAK2_Mmus_DRAK     MSRR--------------------------------------------------------
DAPK3_Mmus_DAPK     MAED--------------------------------------------------------
DAPK2_Mmus_DAPK     MVQA--------------------------------------------------------
DAPK1_Mmus_DAPK     M-----------------------------------------------------------
K12C11.4_Cele_DAPK  MTSI--------------------------------------------------------
DRAK2_Hsap_DRAK     MSRR--------------------------------------------------------
DRAK1_Hsap_DRAK     MIPL--------------------------------------------------------
DAPK3_Hsap_DAPK     M-----------------------------------------------------------
DAPK2_Hsap_DAPK     MFQA--------------------------------------------------------
DAPK1_Hsap_DAPK     M-----------------------------------------------------------
DRAK_Spur_DRAK      ME----------------------------------------------------------
DAPK_Spur_DAPK      M-----------------------------------------------------------
AqueK071_Aque_DAPK  MPYE--------------------------------------------------------
AqueK072_Aque_DAPK  NLTQNLLKIVDNGNLATLRNLLTNESVNVDATNKHGEGALHIAAGYGRLEIVKELRQFGA


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  RLDISDKQGDTPLYWASRHGHNDVVIYLCSNGVDINHQDKSGETATHVAARYGHPDVLES


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  LISFNANLDIQDNDGDTPVLCACWHGFQNIVERLILAGSSLSLTNRDGDTVLHVSSVRGN


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  YTIVRYLCEKGSDLNAVNKEGQTPLYLATKRNHLDIVQFFCEQGCNLNIQDKNGNTPLHE


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ACKDGKLSLVHTLFAAHCKLNVCNKQGMTPLHLAALHNHIEIARHLCSAGSDLNIQDNEG


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  LTVDQLAASTGNNSLAAMLKTLHQEGMRDKCLHEITLGMVQVNKVRLLVCGAADVGKTTL


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  IGSLKARFLRSLRPTKFGGSYLGPAAYRHTFGFCVEQLNIPNAGEFSVWDFSGHKDYYLT


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  HEYFLESRNTIYIVMYNRLHSYEQQLAQVRFWLAMIKSKHRPSKFIHYGGHAGQKPFVIL


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  VQSFADNPNQLPPILFGYNMEDHFDATTSHMRTSSNGVKDRIMSVQEPKRLLQQLVGEFG


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ----------RFD-----------------------CR-------------SVSG-----
DAPK3_Mmus_DAPK     ----------APV-----------------------S-------------P--ES-----
DAPK2_Mmus_DAPK     ----------SM------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ----------ALQ-----------------------LLLL--------LQPYTLT-----
DRAK2_Hsap_DRAK     ----------RFD-----------------------CR-------------SISG-----
DRAK1_Hsap_DRAK     ----------EKPGSGGSSPGATSGSGRAGRGLSGPCRPP--------PPPQARG-----
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ----------SM------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ----------EV------------------------------------------------
AqueK072_Aque_DAPK  HHFMFTDKVFCLD-----------------------CRQPRGREIQSLRSLLGTLRQSML


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     --------LLTT------------------------------------------------
DAPK3_Mmus_DAPK     --------FRRP------------------------------------------------
DAPK2_Mmus_DAPK     ---------RSP------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  --------IRRS------------------------------------------------
DRAK2_Hsap_DRAK     --------LLTT------------------------------------------------
DRAK1_Hsap_DRAK     --------LLT-------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ---------RSP------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  KEQPWVPQLVTTLQQTLPTWRKEYSQFPVMTWEAFLLCVQEQVNPLVTPETLQLVAKALN


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ----------------------------------------------T-------------
DAPK3_Mmus_DAPK     ----------------------------------------------A-------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ----------------------------------------------T-------------
DRAK1_Hsap_DRAK     ----------------------------------------------E-------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  DTGEIIYITEGKLENLLVLNPDWLGQRIFGPALAPEDSLSPQFNSVTGLISLREIRRVYP


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     --------------------------------P---------------------------
DAPK3_Mmus_DAPK     --------------------------------A---------------------------
DAPK2_Mmus_DAPK     --------------------------------N---------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  --------------------------------K---------------------------
DRAK2_Hsap_DRAK     --------------------------------P---------------------------
DRAK1_Hsap_DRAK     --------------------------------I---------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     --------------------------------N---------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ELDPLSVAHLMEHFELCQPVGNREAYQFPLLIRMEPLYGLWEKDPQLTVYAGIRLETSSE


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ANIFSPSVFPRAQLHIRNIFSDDIEDQEVIFWSDGLKCCRGEVEICVRQPEPNRSIEIAV


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     --------------------------------------------------------QTPI
DAPK3_Mmus_DAPK     --------------------------------------------------------MSTF
DAPK2_Mmus_DAPK     --------------------------------------------------------METF
DAPK1_Mmus_DAPK     ---------------------------------------------------------TVF
K12C11.4_Cele_DAPK  --------------------------------------------------------MSTK
DRAK2_Hsap_DRAK     --------------------------------------------------------QIPI
DRAK1_Hsap_DRAK     --------------------------------------------------------RAVV
DAPK3_Hsap_DAPK     ---------------------------------------------------------STF
DAPK2_Hsap_DAPK     --------------------------------------------------------MEPF
DAPK1_Hsap_DAPK     ---------------------------------------------------------TVF
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ---------------------------------------------------------AMF
AqueK071_Aque_DAPK  --------------------------------------------------------ERLV
AqueK072_Aque_DAPK  RGTEDCRTECFALLQQFYEILSNIILDSNPGTSFTLKVLSTRSMAEHQKNPHMYSSMEIF


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  NAERNTGVLNSPNAEIGSGESIVDLLCCGCKELEISVKSAPFTSIRDIPLKTRVELCRML


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  DPPDPFGRDWCLLALQLGVQEDVPVIDVSSDMGSPTDKLLLAWENRSHETVVMLVDALTG


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     -------------------------------------KTENFNN----------------
DAPK3_Mmus_DAPK     -------------------------------------RQEDVED----------------
DAPK2_Mmus_DAPK     -------------------------------------KQQKVED----------------
DAPK1_Mmus_DAPK     -------------------------------------RQENVDD----------------
K12C11.4_Cele_DAPK  -------------------------------------LKQNLEGSFFVVSFSACSPGSKC
DRAK2_Hsap_DRAK     -------------------------------------KMENFNN----------------
DRAK1_Hsap_DRAK     -------------------------------------RTEPFQD----------------
DAPK3_Hsap_DAPK     -------------------------------------RQEDVED----------------
DAPK2_Hsap_DAPK     -------------------------------------KQQKVED----------------
DAPK1_Hsap_DAPK     -------------------------------------RQENVDD----------------
DRAK_Spur_DRAK      ----------------------------------------NHAS----------------
DAPK_Spur_DAPK      -------------------------------------RTESVEE----------------
AqueK071_Aque_DAPK  -------------------------------------RKEKLEE----------------
AqueK072_Aque_DAPK  IGREDVAAELVNGLSPFSNPRNSLFVNIDVIIMSSKDVPKYVQE----------------


CG1760_Dmel_DRAK    -------------------------GSRT-VGKFAAVRRAIHKNTGSHFAAKFLKRRRRA
DRAK2_Mmus_DRAK     ------------------FYTL-TPKELG-RGKFAVVRQCISKSTGQEYAAKSLKKRRRG
DAPK3_Mmus_DAPK     ------------------HYE--MGEELG-SGQFAIVRKCQQKGTGMEYAAKFIKKRRLP
DAPK2_Mmus_DAPK     ------------------FYD--IGEELG-SGQFAIVKKCREKSTGLEYAAKFIKKRQSR
DAPK1_Mmus_DAPK     ------------------YYD--TGEELG-SGQFAVVKKCREKSTGLQYAAKFIKKRRTK
K12C11.4_Cele_DAPK  EISCNITTFRFILYNIAPLFIA-RKQRQR-IGQFAVVRRVRDRKTGEKYAAKFIKKRRYA
DRAK2_Hsap_DRAK     ------------------FYIL-TSKELG-RGKFAVVRQCISKSTGQEYAAKFLKKRRRG
DRAK1_Hsap_DRAK     ------------------GYSLCPGRELG-RGKFAVVRKCIKKDSGKEFAAKFMRKRRKG
DAPK3_Hsap_DAPK     ------------------HYE--MGEELG-SGQFAIVRKCRQKGTGKEYAAKFIKKRRLS
DAPK2_Hsap_DAPK     ------------------FYD--IGEELG-SGQFAIVKKCREKSTGLEYAAKFIKKRQSR
DAPK1_Hsap_DAPK     ------------------YYD--TGEELG-SGQFAVVKKCREKSTGLQYAAKFIKKRRTK
DRAK_Spur_DRAK      ------------------WTLC-GVQLLGVRGRFAVVRKCKHKESNRHFAAKFVRKRKMG
DAPK_Spur_DAPK      ------------------FYQ--IGEDIG-SGQFSEVKKVTEKSTGKDYAGKFIRKRRST
AqueK071_Aque_DAPK  ------------------KYD--VGAELG-RGKFAIVKRVTEKASGEQFAAKFLRKRRGG
AqueK072_Aque_DAPK  ------------------NYN--VVAEIA-KGKFGVVYRCTEKATNSFVAIKVMKGRHNK
                                                   *:*. * :   : :.   * * :: *:

CG1760_Dmel_DRAK    QS----SDKEIKHEIAVLMLCEGEDNIVNLNAVHETRSDTALLLELATGGELQTILDN--
DRAK2_Mmus_DRAK     QD----CRAEILHEIAVLELARSCPHVINLHEVYENATEIILVLEYAAGGEIFNLCLPEL
DAPK3_Mmus_DAPK     SSRRGVSREEIEREVSILREIR-HPNIITLHDVFENKTDVVLILELVSGGELFDFLAE--
DAPK2_Mmus_DAPK     ASRRGVCREEIEREVSILRQVL-HPNIITLHDVYENRTDVVLILELVSGGELFDFLAQ--
DAPK1_Mmus_DAPK     SSRRGVSREDIEREVSILKEIR-HPNVITLHEVYENKTDVILILELVAGGELFDFLAE--
K12C11.4_Cele_DAPK  TSRRGVTRQNIEREVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDHVCA--
DRAK2_Hsap_DRAK     QD----CRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPEL
DRAK1_Hsap_DRAK     QD----CRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADR
DAPK3_Hsap_DAPK     SSRRGVSREEIEREVNILREIR-HPNIITLHDIFENKTDVVLILELVSGGELFDFLAE--
DAPK2_Hsap_DAPK     ASRRGVSREEIEREVSILRQVL-HHNVITLHDVYENRTDVVLILELVSGGELFDFLAQ--
DAPK1_Hsap_DAPK     SSRRGVSREDIEREVSILKEIQ-HPNVITLHEVYENKTDVILILELVAGGELFDFLAE--
DRAK_Spur_DRAK      RD----CREDILKEIRILENSVLNQRLIGLHEVYETSTEVILVLEYASGGELHQYCVADK
DAPK_Spur_DAPK      ASRRGVKREDIVREVSILEELS-HDNIISLHDAFELQKEVVLILELVTGGELFHYLAE--
AqueK071_Aque_DAPK  KA----CRDDIIVEVDIMRQSMGHHRIIKLREVFESPREMIIIIELATGGELFRMIA---
AqueK072_Aque_DAPK  -------KDDVEREVAIMRQLS-HPNILQFIDYVPDKTSYILVTELLNGGELFDYCVT--
                             ::  *: ::        :: :        .  :: *   ***:

CG1760_Dmel_DRAK    EECLTEAQARHCMREVLKALKFLHDRSIAHLDLKPQNILLAGER-IEDGLKLCDFGISRV
DRAK2_Mmus_DRAK     AEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSI-YPLGDIKIVDFGMSRK
DAPK3_Mmus_DAPK     KESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHR
DAPK2_Mmus_DAPK     KESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHE
DAPK1_Mmus_DAPK     KESLTEEEATEFLKQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHK
K12C11.4_Cele_DAPK  KECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRG--DSQIKIIDFGLSRE
DRAK2_Hsap_DRAK     AEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSI-YPLGDIKIVDFGMSRK
DRAK1_Hsap_DRAK     EEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSE-SPLGDIKIVDFGLSRI
DAPK3_Hsap_DAPK     KESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHK
DAPK2_Hsap_DAPK     KESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHE
DAPK1_Hsap_DAPK     KESLTEEEATEFLKQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHK
DRAK_Spur_DRAK      EDGFCEKDVVRLLQQILEGVHYLHSQNIAHLDLKPQNILLTSKETSESDIKLIDFGIARY
DAPK_Spur_DAPK      EDHVNEEVAAQFVKKILEALKHMHDRNICHLDLKPENIMLLNRN--TQNIMLIDFGLSRR
AqueK071_Aque_DAPK  VDPLPEDKARGVVLQLLEGVEHLHSLSIVHLDLKPENILLYRKG--QLDIRIADFGLALQ
AqueK072_Aque_DAPK  KDYVEEAEAVFFMKQILSGLEYMHKRDICHLDLKPENIVLKDES--AKELKIIDFGTCQH
                     : . *  .   : ::* .: .:*   : *:*:**:*::*         : : *** .

CG1760_Dmel_DRAK    VCEGINVREMAGTPDYVAPEVLQYEPLSLLTDIWSVGVL---------------------
DRAK2_Mmus_DRAK     IGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGII---------------------
DAPK3_Mmus_DAPK     IEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
DAPK2_Mmus_DAPK     IEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
DAPK1_Mmus_DAPK     IDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
K12C11.4_Cele_DAPK  IEPGAVVKDMVGTPEFVAPEVVNYEALSPATDMWAVGVV---------------------
DRAK2_Hsap_DRAK     IGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGII---------------------
DRAK1_Hsap_DRAK     LKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVL---------------------
DAPK3_Hsap_DAPK     IEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
DAPK2_Hsap_DAPK     IEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
DAPK1_Hsap_DAPK     IDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVI---------------------
DRAK_Spur_DRAK      LNQGEEIRDIQGTPDYVAPEILNYDPITLSTDMWSIGVL---------------------
DAPK_Spur_DAPK      IKPGEDIRDIMGTAEFVAPEIINFEPLSLNTDMWPVFISSRLPNIQLIQLSRSQVIQLVC
AqueK071_Aque_DAPK  IAPGEQVKTLVGTAEYVAPEILNYEPLSVAADMWSIGAL---------------------
AqueK072_Aque_DAPK  LTKDKAVKALAGTPEFVAPEVLNYDPVTCAADMWAIGVI---------------------
                    :     .: : **.:::***::.::.:   :*:* :

CG1760_Dmel_DRAK    ----------------------------------------------TYVLLSGFSPFGGD
DRAK2_Mmus_DRAK     ----------------------------------------------AYMLLTHTSPFVGE
DAPK3_Mmus_DAPK     ----------------------------------------------TYILLSGASPFLGE
DAPK2_Mmus_DAPK     ----------------------------------------------TYILLSGASPFLGD
DAPK1_Mmus_DAPK     ----------------------------------------------TYILLSGASPFLGD
K12C11.4_Cele_DAPK  ----------------------------------------------TYILLSGGSPFLGD
DRAK2_Hsap_DRAK     ----------------------------------------------AYMLLTHTSPFVGE
DRAK1_Hsap_DRAK     ----------------------------------------------TYVMLTGISPFLGN
DAPK3_Hsap_DAPK     ----------------------------------------------TYILLSGASPFLGE
DAPK2_Hsap_DAPK     ----------------------------------------------TYILLSGASPFLGD
DAPK1_Hsap_DAPK     ----------------------------------------------TYILLSGASPFLGD
DRAK_Spur_DRAK      ----------------------------------------------TYVMLTGISPFAGD
DAPK_Spur_DAPK      VFISPKMGHRREQLALRKMSKALRSDWEHGETALHLAAGYGHVDILEYLQAKGASIDVAD
AqueK071_Aque_DAPK  ----------------------------------------------TYALLTGYSPFQGE
AqueK072_Aque_DAPK  ----------------------------------------------AFCLLTGCSPFLGD
                                                                   :   .  *   .:

CG1760_Dmel_DRAK    TKQETFLNISQCALTFP----DNLFGGVSPVAIDFIRRALRIKPNDRMNATGCLDHIWLK
DRAK2_Mmus_DRAK     DNQETYLNISQVNVDYS----EEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQ
DAPK3_Mmus_DAPK     TKQETLTNISAVNYDFD----EEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIK
DAPK2_Mmus_DAPK     TKQETLANITAVSYDFD----EEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWIT
DAPK1_Mmus_DAPK     TKQETLANVSAVNYDFE----EEFFRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIK
K12C11.4_Cele_DAPK  NRDETFSNITRVRYHFS----DRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWIR
DRAK2_Hsap_DRAK     DNQETYLNISQVNVDYS----EETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQ
DRAK1_Hsap_DRAK     DKQETFLNISQMNLSYS----EEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLT
DAPK3_Hsap_DAPK     TKQETLTNISAVNYDFD----EEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIK
DAPK2_Hsap_DAPK     TKQETLANITAVSYDFD----EEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWIT
DAPK1_Hsap_DAPK     TKQETLANVSAVNYEFE----DEYFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK
DRAK_Spur_DRAK      TKQETFLNISQLNLDFA----EEDFSCHSPEARDFIQSLCVIDAEKRLSAKECLDHPWIQ
DAPK_Spur_DAPK      KTGETPLHVA--------------------------------------------------
AqueK071_Aque_DAPK  THSDTFCNVSMCEYDFE----DEVFDEVSQEAKDFIEELLQKKPSDRLTATKCLSHPWMK
AqueK072_Aque_DAPK  NDAETIQNVTEGEFEFPESDPEEGYDDITDAAKDFISSLLISDPRKRLTSIDAQEHKWIN
                       :*  :::

CG1760_Dmel_DRAK    DDCSLDRQIYLQPQSDAEEEEE--------------------------------------
DRAK2_Mmus_DRAK     QWDFG---SLFHPEET-SG-----------------------------------------
DAPK3_Mmus_DAPK     VRRRE---DG------ARKPE---------------------------------------
DAPK2_Mmus_DAPK     PVDTQ---QAMVRRESVVNLEN--------------------------------------
DAPK1_Mmus_DAPK     PKDTQ---QALSRKASAVNMEK--------------------------------------
K12C11.4_Cele_DAPK  GPEGN---AIDIRKASCITISH--------------------------------------
DRAK2_Hsap_DRAK     QWDFE---NLFHPEET-SS-----------------------------------------
DRAK1_Hsap_DRAK     QSSIQ---EPSFRMEKALE-----------------------------------------
DAPK3_Hsap_DAPK     AIRRR---NVR-GEDSGRKPE---------------------------------------
DAPK2_Hsap_DAPK     PVDNQ---QAMVRRESVVNLEN--------------------------------------
DAPK1_Hsap_DAPK     PKDTQ---QALSRKASAVNMEK--------------------------------------
DRAK_Spur_DRAK      KFSSM---PVTRVLDDNEN-----------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  NHSPT---VLPTSS-TVSSSSHSSAPQSQCLHSSTSSLDSALCLDSNNSSLDPSPSSSAS
AqueK072_Aque_DAPK  GSTSQ---AARINTER--------------------------------------------


CG1760_Dmel_DRAK    --------EDVDDDVEDEEEEE--------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ---------------------RRRLRAA-RLR---EYSLK--------------SHSSMP
DAPK2_Mmus_DAPK     ---------------FKKQYVRRRWKLSFSIVSLCNHLTR---------SLM--KKVHLR
DAPK1_Mmus_DAPK     ---------------FKKFAARKKWKQSVRLISLCQRLSR---------SFL--SRSNMS
K12C11.4_Cele_DAPK  ---------------IQSFKTRQRWKRCVELVMVLLKASK---------SS---------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ---------------------RRRLKTT-RLK---EYTIK--------------SHSSLP
DAPK2_Hsap_DAPK     ---------------FRKQYVRRRWKLSFSIVSLCNHLTR---------SLM--KKVHLR
DAPK1_Hsap_DAPK     ---------------FKKFAARKKWKQSVRLISLCQRLSR---------SFL--SRSNMS
DRAK_Spur_DRAK      ---------------VTQQ---DKYD----------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  SSFAPRPSGRSGDD-DEQEDMKKQL--TEKVSKLCTEMQKVDSSNSALRVNMIGSASSIS
AqueK072_Aque_DAPK  ---------------LKKLRRRRKLLAAIQAVRLSVGLLR---------SFT--RHGSVS


CG1760_Dmel_DRAK    ------QVEEEEEETQNVEEPTTEAPQQQQQPV---------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     RNTSYASF--E-R-----------------------------------------------
DAPK2_Mmus_DAPK     ---T--------------------------------------------------------
DAPK1_Mmus_DAPK     VARSDDTL--D-EEDSFVMKAIIHAINDDNVPGLQHLLGSLSSYDVNQPNKHGTPPLLIA
K12C11.4_Cele_DAPK  RRIGDGRF--D-EEDMVASCTLI-CAEEGNLRALHKL-SALHKLL---------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     PNNSYADF--E-R-----------------------------------------------
DAPK2_Hsap_DAPK     ---P--------------------------------------------------------
DAPK1_Hsap_DAPK     VARSDDTL--D-EEDSFVMKAIIHAINDDNVPGLQHLLGSLSNYDVNQPNKHGTPPLLIA
DRAK_Spur_DRAK      ----------T-EVSSLTINVVI--QNDDNEV----------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  SSDSNTTVRVD-EEDGGIESREMTGTSSEPEPS-------------------LTPPF---
AqueK072_Aque_DAPK  VE-P--------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------QQHQL-------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     AGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWASRHGH---VDTLKFLNENKCPLDVKDK
K12C11.4_Cele_DAPK  ---------PNATRKSLKSSFSEPNGATAMHCAAKYGH---AEVFNYFHMKGGNICARDD
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     AGCGNIQILQLLIKRGSRIDVQDKGGSNAVYWAARHGH---VDTLKFLSENKCPLDVKDK
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ------------------------------------------------------------
AqueK071_Aque_DAPK  ---------------SSQLATPTQTGSSQSFDLSRQSRMMSS------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     SGETALHVAARYGHADVVQLLCSFGSNPDFQD--------------------------KE
K12C11.4_Cele_DAPK  NGDTPLHVACRFAQHTVAGYVANEKIDVDSIN--------------------------KT
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     SGEMALHVAARYGHADVAQLLCSFGSNPNIQD--------------------------KE
DRAK_Spur_DRAK      -------------------------VKKKGTD--------------------------EE
DAPK_Spur_DAPK      ---------GRYGQVEAVQYLCDQAVNSNLAD--------------------------ED
AqueK071_Aque_DAPK  ------------------------SPRPSMEDDTGVGKRPNSRLTTPIDELISLAPDTIE
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ----------------------------------AKS---GQI-----------------
DRAK2_Mmus_DRAK     ---------------------------------SSQ------------------------
DAPK3_Mmus_DAPK     ---------------F------SRVL------EDVAAAE---------------------
DAPK2_Mmus_DAPK     -------------------------------SEDLRNCES--------------------
DAPK1_Mmus_DAPK     EETPLHCAAWHGYYSV------AKALCEVGCNVNIKNREGETPLLTASARGYHDI-----
K12C11.4_Cele_DAPK  GETALHCAVESADTRV------VRLLLQLRPRLDLPNAREETPLHVAAARGHVDC-----
DRAK2_Hsap_DRAK     ---------------------------------SSQ------------------------
DRAK1_Hsap_DRAK     ---------------------------------EANA-----------------------
DAPK3_Hsap_DAPK     ---------------F------SKVL------EEAAAAE---------------------
DAPK2_Hsap_DAPK     -------------------------------DEDLRNCES--------------------
DAPK1_Hsap_DAPK     EETPLHCAAWHGYYSV------AKALCEAGCNVNIKNREGETPLLTASARGYHDI-----
DRAK_Spur_DRAK      NDNY-----------------------------LENR------T----------------
DAPK_Spur_DAPK      GETPLHIAAWHGYTSI------VQTLCKAGATLDLKNKDGETTLLCAAARGHLDI-----
AqueK071_Aque_DAPK  K--------------MKKLERLKRKK------DEAQQ--GEEP------KGRQALTKTLS
AqueK072_Aque_DAPK  -------------------------------APDRRMTEP--------------------


CG1760_Dmel_DRAK    ---------------------------------HSKP--THNGHH---------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------QGLRELQRGRRQC-----------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     --VECLAEHGADLNASDKDGHIALHLAVRRCQMEVIKTLLGHGSFVDFQDRHGN----TP
K12C11.4_Cele_DAPK  --VQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHADHHGD----TA
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------EGLRELQRSRRLC-----------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     --VECLAEHGADLNACDKDGHIALHLAVRRCQMEVIKTLLSQGCFVDYQDRHGN----TP
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      --VKILVEAGALLNTIDKHGITPLHHAVRRQHYDIVKYLVDSNCDVNLQDKLGD----TP
AqueK071_Aque_DAPK  TGQSCISPRGSDRRIS-------SPASIKNQK-LSIK--AQEGSFAEEEEARGAEDTQKP
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    --RANSGGSISKIPIATSKLQSTPS----SETTTAIHTLTSNSN----------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     --------------------RE-----------------------------------RVC
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     LHVACKDGS---APIVVALCEASCNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVE
K12C11.4_Cele_DAPK  LHIASKHGL---LQAVQTLCHCAVTVDSVNANKKTALHLAAHYGHVDIIRVLLLARADVT
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     --------------------HE-----------------------------------DVE
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     LHVACKDGN---MPIVVALCEANCNLDISNKYGRTPLHLAANNGILDVVRYLCLMGASVE
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      LNVACKEGA---LDLVEMLHAVGAKRDILNRHKNSALHMAARGGHIEVVRYLCLAGALIH
AqueK071_Aque_DAPK  SNSPTNTGSTPTVPNVAADAKAKDN----NEISSTAKELAASST---------------A
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    -----GHVHKPTQIVTPTRRASDSDKENTYTATFVKKP----------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ALR-----------------AAAEQREARCRDGS--A-----------------------
DAPK2_Mmus_DAPK     -----------------------DTEENIAR-----------------------------
DAPK1_Mmus_DAPK     ALT-----------------SDGKTAEDLAKAEQ-HE-HVAG------------------
K12C11.4_Cele_DAPK  LRG-----------------DDGLTAELVAVAAE-RL-EAHS------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ALA-----------------AIYEEKEAWYREES--D-----------------------
DAPK2_Hsap_DAPK     -----------------------DTEEDIAR-----------------------------
DAPK1_Hsap_DAPK     ALT-----------------TDGKTAEDLARSEQ-HE-HVAG------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      QRN-----------------QDGLTASQLASLEG-HE-DVAD------------------
AqueK071_Aque_DAPK  KKSTASS--TAKE-LT----ASSTAKESATTSTT-KESAVTGSVPDTAKTSNEKALEATA
AqueK072_Aque_DAPK  -----------------------S------------------------------------


CG1760_Dmel_DRAK    ---------------VATIQLGSSNGIEDATVVATL-----TLFPD--APTTPKVIRKTP
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ----LLARLRKD-------TH--------------RGLFIQQLRPT--QNLQPRIKLKLF
K12C11.4_Cele_DAPK  ----LLKMVKSQ-------EI--------------REEYISQLYPL--DTSLRRIKLKLL
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ----LLARLRKD-------TH--------------RGLFIQQLRPT--QNLQPRIKLKLF
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      ----VLTQVEGD-------KS--------------KDLFINQLNST--SGPLHRIRIKVL
AqueK071_Aque_DAPK  PTSTKNAKIQKDYADKISFTL--------------NSQFVEARRSPKVLNVKPAIDKKVI
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    TGESNGSATSVK--------------------ALVKKFQLEDSS----------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     GHSGSGKSTLVESLKCGL-LRS--FFRRRRPRLS----------STNSTRFPPSPLAAK-
K12C11.4_Cele_DAPK  GHSQSGKTRLVQTLHSSRGISS--FLESVTRRIS----------DH------YSPSSSM-
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     GHSGSGKTTLVESLKCGL-LRS--FFRRRRPRLS----------STNSSRFPPSPLASK-
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      GQSGVGKTALIDSLKCGY-FRG--LFRRSRSNISLIGSSSNGRSSPRSPRSPRSPLTPMF
AqueK071_Aque_DAPK  FFSQGGADQSITGSGGGIEKRSPSSFKR--DILLSKTPKQDDEKPRSKSETPSSPIVSS-
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ---------------------------------P----TVSVSINN------LY------
K12C11.4_Cele_DAPK  ------------------------------------------KDDGIHSTNGSF------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ---------------------------------P----TVSVSINN------LY------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      GNGKKMDGGRFFMESLKRKQLSSTSSSFDVDSEV----TRGIEFTH-----GTIPGAGDF
AqueK071_Aque_DAPK  ---------------------------------KDFAPPPSRSIKS------CS------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ---------------------PGCENVSVRS-RSMMFEPGLTKGML--------------
K12C11.4_Cele_DAPK  --------------------------VSESN-NNSSFDL---------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ---------------------PGCENVSVRS-RSMMFEPGLTKGML--------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      TFLEFSGEDTYHTAYPHFLSDEGAIHLVVFS-LDDMFEEQLAQVTYWMNFLRSQLPATEP
AqueK071_Aque_DAPK  ---------------------PVSTTMTEVKRRAKK------------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     -----------EVF----------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     -----------EVF----------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      VGYCGKYRQQPKIALVATHADHTQCPKQPTGELISGEGNIVLYQTKRLFGRLFDICDVLF
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      VMDANSAQSKDVKMLRTHISSLRNSILKDKSKDLFINQLNSTSGPLHRIRIKVLGQSGVG
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ------------------------------------------------------------
K12C11.4_Cele_DAPK  ------------------------------------------------------------
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ------------------------------------------------------------
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      KTALIDSLKCGYFRGLFRRSRSNISLIGSSSNGRSSPRSPRSPRSPLTPMFGNGKKMDGG
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     ----------VAPSHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYF
K12C11.4_Cele_DAPK  ----------AAAAGSKYAPPHSQYTRGIDVQTVNINGCGEFSVWEFGGYEPMHTCYDHF
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     ----------VAPTHHPHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYF
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      RFFMESLKRKQLSSTSSSFDADSEVTRGIEFTHGTIPGAGDFTFLEFSGEDTYHTAYPHF
AqueK071_Aque_DAPK  --------------------------------------TQDRKSW---------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     AANDPTSIHIIVFSLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVAT
K12C11.4_Cele_DAPK  VGN-ADCIHLILYRTSDPTEVQYKQILYWMNFLKGRVTPFEPIGHCGFSSRRSKVIIVGT
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     AANDPTSIHVVVFSLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLQVVLVAT
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      LSD-EGAIHLVVFSLDDMFEEQLAQVTYWMNFLRSQLPATEPVGYCGKYRQQPKIALVAT
AqueK071_Aque_DAPK  --------------------------------------------------------RNTP
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ----------------------------------------GS------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     ------------------------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     HADIMNIPRP-AGGEFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRN
K12C11.4_Cele_DAPK  HATSSLFPQMNQEGEYVSSDIEAMLNTVRLRFETHFDMDHRLILLDATNPSCIGMKTLKM
DRAK2_Hsap_DRAK     ------------------------------------------------------------
DRAK1_Hsap_DRAK     ------------------------------------------------------------
DAPK3_Hsap_DAPK     ------------------------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     HADIMNVPRP-AGGEFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRN
DRAK_Spur_DRAK      ------------------------------------------------------------
DAPK_Spur_DAPK      HADHTQCPKQ-PTGEMISGEGNIVLYQTKRLFGRLFDICDVLFVMDANSAQSKDVKMLRT
AqueK071_Aque_DAPK  HIDPDVIEA-MLRGEFDIDDDESSSEAKLETMKEEVEPRNES------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ---------------------------------------IQD------------------
DAPK3_Mmus_DAPK     --------------------------------------------------------GLGR
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     HLQEIRSQIVSGCSPMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASED
K12C11.4_Cele_DAPK  ELAKCRTNILAKLLKPLAILDTVVNHLNLVRKKHANFPVITWPDFIQLVRNEINPLTGDA
DRAK2_Hsap_DRAK     ---------------------------------------TQD------------------
DRAK1_Hsap_DRAK     ---------------------------------------LQE---------G--------
DAPK3_Hsap_DAPK     --------------------------------------------------------SLGQ
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     HLQEIRSQIVSVCPPMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEE
DRAK_Spur_DRAK      ------------------------VEYVSPREVKSPNEQVQDSEACLDVRSG--------
DAPK_Spur_DAPK      HISSLRNSILKVEAPVSVLCEAVASALPAWRRTFVNFPVLTWQQFSEGIHASINPLAGQA
AqueK071_Aque_DAPK  ------------------------------------------------------------
AqueK072_Aque_DAPK  ------------------------------------------------------------


CG1760_Dmel_DRAK    AVARRSGGAVTSSSGLH---SPTTTSV---------RLNSIRRASEPLT-----TVYKKQ
DRAK2_Mmus_DRAK     ---------------------------------------------------------LT-
DAPK3_Mmus_DAPK     D---------------------------------------------LRRLRTELGRTEA-
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     D---------------------------------------------LRRIAQQLHSTGE-
K12C11.4_Cele_DAPK  H---------------------------------------------CRQIVQQLQLIGE-
DRAK2_Hsap_DRAK     ---------------------------------------------------------HS-
DRAK1_Hsap_DRAK     ---------------------------------------------------------HS-
DAPK3_Hsap_DAPK     D---------------------------------------------LRRLRQELLKTEA-
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     D---------------------------------------------LRRIAQQLHSTGE-
DRAK_Spur_DRAK      ---------------------------------------------------------II-
DAPK_Spur_DAPK      H---------------------------------------------LREVGRQLHLMGE-
AqueK071_Aque_DAPK  PLAGRTGTVVLSGTKSHVSLSPTATPILKKGCFSDPHLERVTKSESPRRVVMMVSATRP-
AqueK072_Aque_DAPK  ------------------------------------------------------IRLST-


CG1760_Dmel_DRAK    TSQNGCSSTSN-PS----------------------------------------------
DRAK2_Mmus_DRAK     --LR--------------------------------------------------------
DAPK3_Mmus_DAPK     --LRTRAQEEA-RA----------------------------------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     --INIMQSETV-QDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDS-
K12C11.4_Cele_DAPK  --LVYLRNDLCDADYVVLNAEWFGTHILGQLLSAEFLS-KASPNGSYHTSSLAKIFPEIP
DRAK2_Hsap_DRAK     --VR--------------------------------------------------------
DRAK1_Hsap_DRAK     --VP--------------------------------------------------------
DAPK3_Hsap_DAPK     --LKRQAQEEA-KG----------------------------------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     --INIMQSETV-QDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDIQRLVPDS-
DRAK_Spur_DRAK      --IE--------------------------------------------------------
DAPK_Spur_DAPK      --VQCFGSELLQ-EVIVIEPTWLCSGIIGRLLSHDAT---EQPEGQYSIHYIQSLFPDT-
AqueK071_Aque_DAPK  --ETSLESSSS-PDR---------------------------------------------
AqueK072_Aque_DAPK  --PPSSAPATN-PG----------------------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     -------------SSEEKTSKSSC------------------------------------
DAPK3_Mmus_DAPK     -----------------------------ALLGAGGLKR---------------------
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     DVEELLQILDA-MDICARDLSSGTMVDIPALIKTDSLQRSWA-----------------D
K12C11.4_Cele_DAPK  EQSDLMTILEV-LQLCAPDARTG-AHEFPVFIQTEAPDSIWRPYSL-------------K
DRAK2_Hsap_DRAK     -------------SSEDKTSKSSC------------------------------------
DRAK1_Hsap_DRAK     -------------EINSDTDKSETKESI--VTEE-----------LIVVTS---------
DAPK3_Hsap_DAPK     -----------------------------ALLGTSGLKR---------------------
DAPK2_Hsap_DAPK     ------------------------------------------------------------
DAPK1_Hsap_DAPK     DVEELLQILDA-MDICARDLSSGTMVDVPALIKTDNLHRSWA-----------------D
DRAK_Spur_DRAK      ---EILSDMDVHMDVESKDGQTDTTQDLPHIQEE-----------VQVLSQYSKSFEVLD
DAPK_Spur_DAPK      DAMDISQLMEA-MDICVH----GTVCEIPAVMRCPAPEGIWE-----------------K
AqueK071_Aque_DAPK  ------------------TPPI--------------------------------------
AqueK072_Aque_DAPK  -----------------------------S------------------------------


CG1760_Dmel_DRAK    ------------------------------------------------------------
DRAK2_Mmus_DRAK     ------------------------------------------------------------
DAPK3_Mmus_DAPK     --------------------------------------------------------RLCR
DAPK2_Mmus_DAPK     ------------------------------------------------------------
DAPK1_Mmus_DAPK     EE--DEVMVYGGVRIVPVEHLTPFPC