Protein (view, download) , Domain (view, download)
CC1G_01565_Ccin  MEHGRYPTFVLD------------------------------------------------
CC1G_02101_Ccin  MHLLNVKD----------------------------------------------------
CC1G_02514_Ccin  MSDKEYFTPGG-------------------------------------------------
CC1G_04351_Ccin  MTDSTEAESLYL------------------------------------------------
CC1G_04368_Ccin  MTDSTEAESLYL------------------------------------------------
CC1G_04369_Ccin  MTTSSHATTAD-------------------------------------------------
CC1G_06995_Ccin  MFPFNT------------------------------------------------------
CC1G_07007_Ccin  MTE---------------------------------------------------------
CC1G_07017_Ccin  MGRRQDDGGSIHTKSLVIWGGGLPFGPGQWSPNSTKRLLTSYHDIHFISQIQQIHNSLLS
CC1G_07297_Ccin  MASDPFPNE---------------------------------------------------
CC1G_09552_Ccin  MSLPGIFTQQC-------------------------------------------------
CC1G_09560_Ccin  MTVSTAA-----------------------------------------------------
CC1G_09643_Ccin  MSPKEKTPD---------------------------------------------------
CC1G_10350_Ccin  MSPAPKPPRKA-------------------------------------------------
CC1G_10359_Ccin  MSNSQSHTASQ-------------------------------------------------
CC1G_10438_Ccin  MQSAKPLFK---------------------------------------------------
CC1G_15125_Ccin  MVRVALKPGMDRLDSVEGLETEPWIGSVEGTIRLSILPVYGLADGRCWIMLSASEVEEGS
CC1G_12300_Ccin  MKASTCPIT---------------------------------------------------
CC1G_13086_Ccin  MCMTVSTAA---------------------------------------------------
CC1G_13585_Ccin  MATSSHATTAD-------------------------------------------------
CC1G_15853_Ccin  MLPASYPYR---------------------------------------------------
CC1G_14751_Ccin  MTANRRTPA---------------------------------------------------
CC1G_02149_Ccin  MAEL--------------------------------------------------------
CC1G_15618_Ccin  MKPTD-------------------------------------------------------
CC1G_15846_Ccin  MTISPDMFY---------------------------------------------------
CC1G_15850_Ccin  MPSLARTIFDS-------------------------------------------------
CC1G_02150_Ccin  MKPTTEPI----------------------------------------------------
CC1G_07006_Ccin  MAIS--------------------------------------------------------
CC1G_07298_Ccin  MSFMSIVTR---------------------------------------------------
CC1G_08376_Ccin  MQASPLSLRSH-------------------------------------------------
CC1G_09646_Ccin  MSGGDCATP---------------------------------------------------
CC1G_07441_Ccin  MDAN--------------------------------------------------------
CC1G_09364_Ccin  MNAD--------------------------------------------------------
CC1G_07025_Ccin  MNDN--------------------------------------------------------
CC1G_13267_Ccin  MAPRSLPPR---------------------------------------------------
CC1G_09374_Ccin  MAPRSLPPR---------------------------------------------------
CC1G_07033_Ccin  MSSE--------------------------------------------------------
CC1G_09362_Ccin  MSSE--------------------------------------------------------
CC1G_07011_Ccin  MPTERSNTYP--------------------------------------------------
CC1G_06992_Ccin  MTSYDDTLP---------------------------------------------------
CC1G_09375_Ccin  MKPT--------------------------------------------------------
CC1G_13268_Ccin  MVRVERDASCLQTITIL----------------------------------------KEF
CC1G_02099_Ccin  M-----------------------------------------------------------
CC1G_15127_Ccin  MPPATHPLK---------------------------------------------------
CC1G_07432_Ccin  MEPQ--------------------------------------------------------
CC1G_15855_Ccin  MGYE--------------------------------------------------------
CC1G_03062_Ccin  MIKNDD------------------------------------------------------
CC1G_03063_Ccin  MIKNDD------------------------------------------------------
CC1G_02515_Ccin  MNMAPYSVAGD-------------------------------------------------
CC1G_07020_Ccin  MDID--------------------------------------------------------
CC1G_10360_Ccin  MVDSEMTADDV-------------------------------------------------
CC1G_02093_Ccin  MGR---------------------------------------------------------
CC1G_14491_Ccin  MTRTNTRGQ---------------------------------------------------
CC1G_12151_Ccin  MIQLVED-D---------------------------------------------------
CC1G_12150_Ccin  MGDAAITTP---------------------------------------------------
CC1G_09618_Ccin  MAETRTGSS---------------------------------------------------
CC1G_09771_Ccin  MVSRRSLRSAA-------------------------------------------------
CC1G_02098_Ccin  MNEEHLNTV---------------------------------------------------
CC1G_09358_Ccin  M-----------------------------------------------------------
CC1G_12699_Ccin  MRN---------------------------------------------------------
CC1G_15275_Ccin  MSCSRSDEEND-------------------------------------------------
CC1G_04128_Ccin  MRVKQDLP----------------------------------------------------
CC1G_09382_Ccin  MT----------------------------------------------------------
CC1G_07035_Ccin  MGYE--------------------------------------------------------
CC1G_12692_Ccin  MAFT--------------------------------------------------------
CC1G_07032_Ccin  MTLYSLPF----------------------------------------------------
CC1G_07452_Ccin  MRPTTEPI----------------------------------------------------
CC1G_07436_Ccin  M-----------------------------------------------------------
CC1G_02612_Ccin  MAECFPTLA---------------------------------------------------
CC1G_07447_Ccin  MKPTTEPI----------------------------------------------------
CC1G_15137_Ccin  MVDL--------------------------------------------------------
CC1G_07010_Ccin  MGRLKTFPH---------------------------------------------------
CC1G_09363_Ccin  MV----------------------------------------------------------
CC1G_15136_Ccin  MSPATPKR----------------------------------------------------
CC1G_12646_Ccin  MNTK--------------------------------------------------------
CC1G_07434_Ccin  MDSP--------------------------------------------------------
CC1G_07019_Ccin  MGSD--------------------------------------------------------
CC1G_07016_Ccin  MSNE--------------------------------------------------------
CC1G_07008_Ccin  MVND--------------------------------------------------------
CC1G_07022_Ccin  MDAE--------------------------------------------------------
CC1G_07031_Ccin  MKT---------------------------------------------------------
CC1G_07431_Ccin  MRMDI-------------------------------------------------------
CC1G_07024_Ccin  MGRLKTFPH---------------------------------------------------
CC1G_06991_Ccin  MEAD--------------------------------------------------------
CC1G_15854_Ccin  MTSG--------------------------------------------------------
CC1G_07009_Ccin  MNDE--------------------------------------------------------
CC1G_07435_Ccin  MIPATCPNP---------------------------------------------------
CC1G_15120_Ccin  MPSE--------------------------------------------------------
CC1G_15126_Ccin  METN--------------------------------------------------------
CC1G_09389_Ccin  MDSE--------------------------------------------------------
CC1G_09368_Ccin  MDSK--------------------------------------------------------
CC1G_08271_Ccin  MKSF--------------------------------------------------------
CC1G_15123_Ccin  MVNE--------------------------------------------------------
CC1G_12693_Ccin  MFTVKTV-----------------------------------------------------
CC1G_07268_Ccin  MKPTF-------------------------------------------------------
CC1G_14317_Ccin  MSDSEDEIV---------------------------------------------------
CC1G_14316_Ccin  MSSPTNNSD---------------------------------------------------
CC1G_07012_Ccin  MASE--------------------------------------------------------
CC1G_09460_Ccin  MKPTD-------------------------------------------------------
CC1G_02609_Ccin  MHAPDRHPA---------------------------------------------------
CC1G_02100_Ccin  METEQLKAS---------------------------------------------------
CC1G_02621_Ccin  MDWFRTPAS---------------------------------------------------
CC1G_02216_Ccin  MDG---------------------------------------------------------
CC1G_02242_Ccin  MDG---------------------------------------------------------
CC1G_02243_Ccin  MDG---------------------------------------------------------
CC1G_13589_Ccin  MDQLFRNRNKP-------------------------------------------------
CC1G_04033_Ccin  MSDSNIQQRTP-------------------------------------------------
CC1G_09461_Ccin  MGGNRVPHHRCA------------------------------------------------
CC1G_15619_Ccin  MEASPLKPAL--------------------------------------------------
CC1G_09455_Ccin  MYEHLTTTLNR-------------------------------------------------
CC1G_15613_Ccin  MVQPERRGEER-------------------------------------------------
CC1G_07207_Ccin  MFTGGHQGT---------------------------------------------------
CC1G_10437_Ccin  MPNRMSTPE---------------------------------------------------
CC1G_10443_Ccin  MSPTAKPPRKP-------------------------------------------------
CC1G_02608_Ccin  MTY---------------------------------------------------------
CC1G_02097_Ccin  MKEAQLNTE---------------------------------------------------
CC1G_07425_Ccin  MEAT--------------------------------------------------------
CC1G_11607_Ccin  MLPIPLVATV--------------------------------------------------
CC1G_03064_Ccin  MSEELPGDT---------------------------------------------------
CC1G_10358_Ccin  MNEHGFSSG---------------------------------------------------
CC1G_11333_Ccin  MGKRSSSTVKA-------------------------------------------------
CC1G_05033_Ccin  MGPEQSPSGEL-------------------------------------------------
CC1G_13269_Ccin  MDSK--------------------------------------------------------
CC1G_07445_Ccin  MDSK--------------------------------------------------------
CC1G_07453_Ccin  MGYE--------------------------------------------------------
CC1G_15248_Ccin  MEHGRYPTFVLD------------------------------------------------
CC1G_05049_Ccin  MSASTPVIVRQ-------------------------------------------------
CC1G_10439_Ccin  MYKMQLLE----------------------------------------------------
                 *

CC1G_01565_Ccin  -----GPDD------------FLLEELLKHLT----------------------------
CC1G_02101_Ccin  ------------------------------------------------------------
CC1G_02514_Ccin  ---------------------------------------------------R--T----F
CC1G_04351_Ccin  -------NF------------R--G-------KP--------------------------
CC1G_04368_Ccin  -------NF------------R--G-------KP--------------------------
CC1G_04369_Ccin  -------E----------------------------------------------------
CC1G_06995_Ccin  ------PQH------------SP-Q-------KP-----------------D--------
CC1G_07007_Ccin  ------------------------------------------------------------
CC1G_07017_Ccin  IPKFFTPQH------------TP-Q-------KP-----------------G--------
CC1G_07297_Ccin  -----LL-----------------------------------------------------
CC1G_09552_Ccin  -------D----------------T-------RPRS--------D------T--N----I
CC1G_09560_Ccin  ------------------------------------------------------------
CC1G_09643_Ccin  -----LIRD------------HE-T-------GA-----------------T--D----V
CC1G_10350_Ccin  ------ATR------------S--A-----------------------------------
CC1G_10359_Ccin  -------VF------------S--S-------DTRSTVARLSKAD------T--L----L
CC1G_10438_Ccin  ------------------------------------------------------------
CC1G_15125_Ccin  PRN---PTL------------TT-MT------SS-----------------W--------
CC1G_12300_Ccin  --PPRNPAG------------EP-V-------RG-----------------Q--------
CC1G_13086_Ccin  ------------------------------------------------------------
CC1G_13585_Ccin  -------E----------------------------------------------------
CC1G_15853_Ccin  -----TPIR------------KI-L-------RK-----------------Q--------
CC1G_14751_Ccin  -----VSDA------------TQ-Q-------PA-----------------A--STTSEL
CC1G_02149_Ccin  ------------------------------------------------------------
CC1G_15618_Ccin  ------------------------------------------------------------
CC1G_15846_Ccin  -----GARS------------SN-L-------AA-----------------A--A-----
CC1G_15850_Ccin  ------EAD------------HP-T--------PV----------------G--------
CC1G_02150_Ccin  -----TPKR------------DP-V-------AQ-----------------A--------
CC1G_07006_Ccin  ------------------------------------------------------------
CC1G_07298_Ccin  -----TIIGMSFMTLSGPRILAD-D-------RR-----------------TLRF-----
CC1G_08376_Ccin  ------GL--------------A-EY------E---------------------------
CC1G_09646_Ccin  -----FVDQ------------G--------------------------------R-----
CC1G_07441_Ccin  ------------------------------------------------------------
CC1G_09364_Ccin  ------------------------------------------------------------
CC1G_07025_Ccin  ------------------------------------------------------------
CC1G_13267_Ccin  -----TPKK------------YK-K-------KL-----------------A--------
CC1G_09374_Ccin  -----TPKK------------YK-K-------RP-----------------G--------
CC1G_07033_Ccin  ------------------------------------------------------------
CC1G_09362_Ccin  ------------------------------------------------------------
CC1G_07011_Ccin  --NYETPQH------------TP-Q-------KC-----------------G--------
CC1G_06992_Ccin  --NFKTPQY------------GR-V-------RR-----------------V--------
CC1G_09375_Ccin  ------------------------------------------------------------
CC1G_13268_Ccin  PSCRIFPPP------------QT-IT------GH-----------------L--------
CC1G_02099_Ccin  ------------------------------------------------------------
CC1G_15127_Ccin  -----TPRR------------KP-R-------GK-----------------V--------
CC1G_07432_Ccin  ------------------------------------------------------------
CC1G_15855_Ccin  ------------------------------------------------------------
CC1G_03062_Ccin  ------------------------------------------------------------
CC1G_03063_Ccin  ------------------------------------------------------------
CC1G_02515_Ccin  ---------------------------------------------------S--K----F
CC1G_07020_Ccin  ------------------------------------------------------------
CC1G_10360_Ccin  ------------------------------------------------------------
CC1G_02093_Ccin  ------------------------------------------------------------
CC1G_14491_Ccin  -----KRRQ------------R--------------------------------------
CC1G_12151_Ccin  -----LED--------------A-L-----------------------------------
CC1G_12150_Ccin  -----TNK--------------P-I-----------------------------------
CC1G_09618_Ccin  -----IPQN------------QP-V-----------------------------------
CC1G_09771_Ccin  ------R-N------------AP-NM------NPI----------------TP-------
CC1G_02098_Ccin  -----YPPA---------------------------------------------------
CC1G_09358_Ccin  ------------------------------------------------------------
CC1G_12699_Ccin  ------------------------------------------------------------
CC1G_15275_Ccin  --------N------------NV-DALLSVVN----------------------------
CC1G_04128_Ccin  ------------------------------------------------------------
CC1G_09382_Ccin  ------------------------------------------------------------
CC1G_07035_Ccin  ------------------------------------------------------------
CC1G_12692_Ccin  ------------------------------------------------------------
CC1G_07032_Ccin  ----LTPPG------------KK-R-------ST-----------------H--------
CC1G_07452_Ccin  -----TPKR------------DP-V-------AQ-----------------A--------
CC1G_07436_Ccin  ------------------------------------------------------------
CC1G_02612_Ccin  -----T-VF------------LA-LQ------RQ-----------------G--------
CC1G_07447_Ccin  -----TPKR------------DP-V-------AQ-----------------A--------
CC1G_15137_Ccin  ------------------------------------------------------------
CC1G_07010_Ccin  ----NTPQH------------TP-Q-------KP-----------------G--------
CC1G_09363_Ccin  ------------------------------------------------------------
CC1G_15136_Ccin  -----RT---------------L-V-------NL-----------------G--------
CC1G_12646_Ccin  ------------------------------------------------------------
CC1G_07434_Ccin  ------------------------------------------------------------
CC1G_07019_Ccin  ------------------------------------------------------------
CC1G_07016_Ccin  ------------------------------------------------------------
CC1G_07008_Ccin  ------------------------------------------------------------
CC1G_07022_Ccin  ------------------------------------------------------------
CC1G_07031_Ccin  ------------------------------------------------------------
CC1G_07431_Ccin  ------------------------------------------------------------
CC1G_07024_Ccin  ----NTPQH------------TP-Q-------KP-----------------G--------
CC1G_06991_Ccin  ------------------------------------------------------------
CC1G_15854_Ccin  ------------------------------------------------------------
CC1G_07009_Ccin  ------------------------------------------------------------
CC1G_07435_Ccin  ----ATPSR------------NL-A-------GK-----------------T--------
CC1G_15120_Ccin  ------------------------------------------------------------
CC1G_15126_Ccin  ------------------------------------------------------------
CC1G_09389_Ccin  ------------------------------------------------------------
CC1G_09368_Ccin  ------------------------------------------------------------
CC1G_08271_Ccin  ------------------------------------------------------------
CC1G_15123_Ccin  ------------------------------------------------------------
CC1G_12693_Ccin  ------------------------------------------------------------
CC1G_07268_Ccin  ------------------------------------------------------------
CC1G_14317_Ccin  -----QSTL---------------------------------------------------
CC1G_14316_Ccin  -----GNV----------------------------------------------------
CC1G_07012_Ccin  ------------------------------------------------------------
CC1G_09460_Ccin  ------------------------------------------------------------
CC1G_02609_Ccin  -----ATAM------------SD-S--------E--------------------------
CC1G_02100_Ccin  -----EQDQ------------NY---------F---------------------------
CC1G_02621_Ccin  -----SPIA------------HS-A-------PV--------------------------
CC1G_02216_Ccin  ------------------------------------------------------------
CC1G_02242_Ccin  ------------------------------------------------------------
CC1G_02243_Ccin  ------------------------------------------------------------
CC1G_13589_Ccin  -------D-------------------------------------------S--Q-----
CC1G_04033_Ccin  -------TK------------G-----------------------------K--K----L
CC1G_09461_Ccin  ------PDC------------TA-T-------HPQVELDDIGRDEGDAIKTH--S----I
CC1G_15619_Ccin  ------Q--------------------------------------------H--S----I
CC1G_09455_Ccin  ------W-----------------------------------------------------
CC1G_15613_Ccin  ------E--------------------------------------------R--E-----
CC1G_07207_Ccin  ----CFPRA------------YN-I-------EA--------------------------
CC1G_10437_Ccin  ------PGF------------SA-R-------KQ-----------------T--R-----
CC1G_10443_Ccin  ------ATR------------S--V-----------------------------------
CC1G_02608_Ccin  ------------------------------------------------------------
CC1G_02097_Ccin  -----SPA------------------------L---------------------------
CC1G_07425_Ccin  ------------------------------------------------------------
CC1G_11607_Ccin  ------------------------------------------------------------
CC1G_03064_Ccin  -----G------------------------------------------------------
CC1G_10358_Ccin  ------------------------------------------------------------
CC1G_11333_Ccin  -----APS--------------A-KRH-----RA--------------------------
CC1G_05033_Ccin  ------SE--------------P-TS------SPY----------------SL-------
CC1G_13269_Ccin  ------------------------------------------------------------
CC1G_07445_Ccin  ------------------------------------------------------------
CC1G_07453_Ccin  ------------------------------------------------------------
CC1G_15248_Ccin  -----GPDD------------FLLEELLKHLT----------------------------
CC1G_05049_Ccin  -----A--P------------FA-LNNRPERQIF--------------------------
CC1G_10439_Ccin  ------------------------------------------------------------


CC1G_01565_Ccin  ------------------------------------------------------------
CC1G_02101_Ccin  ------------------------------------------------------------
CC1G_02514_Ccin  ---------D--R----NLYKDV-------------------------------------
CC1G_04351_Ccin  ------------------------------------------------------------
CC1G_04368_Ccin  ------------------------------------------------------------
CC1G_04369_Ccin  ------------------------------------------------------------
CC1G_06995_Ccin  -----------------PK--TA--------SNA-TPR---PS---RHIA----------
CC1G_07007_Ccin  ------------------------------------------------------------
CC1G_07017_Ccin  -----------------AK--TI--------TKD-TPR---TK---RNIV----------
CC1G_07297_Ccin  ------------------------------------------------------------
CC1G_09552_Ccin  -------------------------------K----------------------------
CC1G_09560_Ccin  ------------------------------------------------------------
CC1G_09643_Ccin  --------------------------------AS-SPT---GANKERMF-----------
CC1G_10350_Ccin  -----------------AKSKDS---------LS-QPAEPTTM-----------------
CC1G_10359_Ccin  -------------------------------K----------------------------
CC1G_10438_Ccin  ------------------------------------------------------------
CC1G_15125_Ccin  --------------SRSVLRTKG--------ACLVLTT---NA---IGHLQDSE------
CC1G_12300_Ccin  ------------------FTAPA--------LGT-SPR---SA---PNRP----------
CC1G_13086_Ccin  ------------------------------------------------------------
CC1G_13585_Ccin  ------------------------------------------------------------
CC1G_15853_Ccin  -----------------VNVAAT--------GSV-TPR---CV---ADLA----------
CC1G_14751_Ccin  SDTVGPLVTL--PPRTPNRTVRL-ASG----FQS-TPL---AE---RSTQ----------
CC1G_02149_Ccin  ------------------------------------------------------------
CC1G_15618_Ccin  ------------------------------------------------------------
CC1G_15846_Ccin  --------------------------------TR-TPE---SQ---RFMS----------
CC1G_15850_Ccin  -----------------VEFRSC---------ED-TPGHRSTR----SG-----------
CC1G_02150_Ccin  --------------AFGAKSAP---------VGA-TPR---TG---QDIT----------
CC1G_07006_Ccin  ------------------------------------------------------------
CC1G_07298_Ccin  --------YQ--SPSHPPDSN--LRSGVTTTFHV-RIE---ED-KD---T----------
CC1G_08376_Ccin  ------------------------------------------------------------
CC1G_09646_Ccin  --------VQ--RPSMFAMTSPMIPSGI-SRL----------------------------
CC1G_07441_Ccin  ------------------------------------------------------------
CC1G_09364_Ccin  ------------------------------------------------------------
CC1G_07025_Ccin  ------------------------------------------------------------
CC1G_13267_Ccin  ----------------HARTVPN--------PKD-TPR---SL---PSLA----------
CC1G_09374_Ccin  ----------------HARTEPK--------PKD-TPR---SL---PSLA----------
CC1G_07033_Ccin  ------------------------------------------------------------
CC1G_09362_Ccin  ------------------------------------------------------------
CC1G_07011_Ccin  -----------------IATVPN--------VTE-TPR---EA---RPLA----------
CC1G_06992_Ccin  -----------------PK--AI--------TAY-TPA---EN---RIIA----------
CC1G_09375_Ccin  ------------------------------------------------------------
CC1G_13268_Ccin  -------------------------------------------------NMMPL------
CC1G_02099_Ccin  ------------------------------------------------------------
CC1G_15127_Ccin  -----------------DRFTTL--------LQE-TPR---RS---TTNA----------
CC1G_07432_Ccin  ------------------------------------------------------------
CC1G_15855_Ccin  ------------------------------------------------------------
CC1G_03062_Ccin  ------------------------------------------------------------
CC1G_03063_Ccin  ------------------------------------------------------------
CC1G_02515_Ccin  ---------H--K----TLYEGV-------------------------------------
CC1G_07020_Ccin  ------------------------------------------------------------
CC1G_10360_Ccin  ------------------------------------------------------------
CC1G_02093_Ccin  ------------------------------------------------------------
CC1G_14491_Ccin  -------------VISGQQGR--DE-----------------------------------
CC1G_12151_Ccin  ---------H--T-----------------------------------------------
CC1G_12150_Ccin  ---------E--LPKTNVTPT--RECKA-SNAE---------------------------
CC1G_09618_Ccin  ---------E--RPTCSSRSS--NDASG-S------------------------------
CC1G_09771_Ccin  -----------------TRTRRN----------R-VASSPDT------------------
CC1G_02098_Ccin  ------------------------------------------------------------
CC1G_09358_Ccin  ------------------------------------------------------------
CC1G_12699_Ccin  ------------------------------------------------------------
CC1G_15275_Ccin  ------------------------------------------------------------
CC1G_04128_Ccin  ------------------------------------------------------------
CC1G_09382_Ccin  ------------------------------------------------------------
CC1G_07035_Ccin  ------------------------------------------------------------
CC1G_12692_Ccin  ------------------------------------------------------------
CC1G_07032_Ccin  -----------------WSALAK--------MLV-TPR---TA---PARA----------
CC1G_07452_Ccin  --------------APGAVSAP---------VGT-TPR---TG---QDIT----------
CC1G_07436_Ccin  ------------------------------------------------------------
CC1G_02612_Ccin  --------------NGGNEPKNR--------YLFTNPQ---SA---RESV----------
CC1G_07447_Ccin  --------------VFGAKSAP---------VGT-TPR---TG---QDIA----------
CC1G_15137_Ccin  ------------------------------------------------------------
CC1G_07010_Ccin  -----------------AK--TI--------TKD-TPR---KP---KRIA----------
CC1G_09363_Ccin  ------------------------------------------------------------
CC1G_15136_Ccin  --------------HGGSLSEPI--------VTS-TPR---SK---LNAT----------
CC1G_12646_Ccin  ------------------------------------------------------------
CC1G_07434_Ccin  ------------------------------------------------------------
CC1G_07019_Ccin  ------------------------------------------------------------
CC1G_07016_Ccin  ------------------------------------------------------------
CC1G_07008_Ccin  ------------------------------------------------------------
CC1G_07022_Ccin  ------------------------------------------------------------
CC1G_07031_Ccin  ------------------------------------------------------------
CC1G_07431_Ccin  ------------------------------------------------------------
CC1G_07024_Ccin  -----------------AK--TI--------TKD-TPR---TS---RRTA----------
CC1G_06991_Ccin  ------------------------------------------------------------
CC1G_15854_Ccin  ------------------------------------------------------------
CC1G_07009_Ccin  ------------------------------------------------------------
CC1G_07435_Ccin  --------------DLDSLTEPI--------NTE-TPR---TS---SGRA----------
CC1G_15120_Ccin  ------------------------------------------------------------
CC1G_15126_Ccin  ------------------------------------------------------------
CC1G_09389_Ccin  ------------------------------------------------------------
CC1G_09368_Ccin  ------------------------------------------------------------
CC1G_08271_Ccin  ------------------------------------------------------------
CC1G_15123_Ccin  ------------------------------------------------------------
CC1G_12693_Ccin  ------------------------------------------------------------
CC1G_07268_Ccin  ------------------------------------------------------------
CC1G_14317_Ccin  ----------------------------------SSPA---NS---DGNLSHSNVDYEDY
CC1G_14316_Ccin  --------------------------------------------------SHSNVDYEHY
CC1G_07012_Ccin  ------------------------------------------------------------
CC1G_09460_Ccin  ------------------------------------------------------------
CC1G_02609_Ccin  -----------------GEA-TQ--------SALSSPT---NS---NGNLTDSNVEYDGY
CC1G_02100_Ccin  ----------------DSRTAA--------------------------------------
CC1G_02621_Ccin  -----------------NDA-SV--------KIF-TPR---QD---PDAV----------
CC1G_02216_Ccin  ------------------------------------------------------------
CC1G_02242_Ccin  ------------------------------------------------------------
CC1G_02243_Ccin  ------------------------------------------------------------
CC1G_13589_Ccin  ------------------------------------------------------------
CC1G_04033_Ccin  ---------SS-Q----SRYERT--------RSR-T------------------------
CC1G_09461_Ccin  ---------STSR----AVSPTL--------SQQ-T------------------------
CC1G_15619_Ccin  ---------STPS----AVSATL--------SQQ-T------------------------
CC1G_09455_Ccin  ------------------------------------------------------------
CC1G_15613_Ccin  ------------------------------------------------------------
CC1G_07207_Ccin  -----------------PAP-SA--------QGT-SPR---TV---RTH-----------
CC1G_10437_Ccin  --------TE--EPRTPPRSVPTVQATA-TTVSV-TPF---KSKSS---R----------
CC1G_10443_Ccin  -----------------AKSKDS---------LS-QPAEPTTM-----------------
CC1G_02608_Ccin  ------------------------------------------------------------
CC1G_02097_Ccin  ----------------PTRSGK--------------------------------------
CC1G_07425_Ccin  ------------------------------------------------------------
CC1G_11607_Ccin  ------------------------------------------------------------
CC1G_03064_Ccin  ------------------------------------------------------------
CC1G_10358_Ccin  ------------------------------------------------------------
CC1G_11333_Ccin  -------------------------------HGY-EAV---S------------------
CC1G_05033_Ccin  -----------------QRS------------PS-SPDTPGSA---STA-----------
CC1G_13269_Ccin  ------------------------------------------------------------
CC1G_07445_Ccin  ------------------------------------------------------------
CC1G_07453_Ccin  ------------------------------------------------------------
CC1G_15248_Ccin  ------------------------------------------------------------
CC1G_05049_Ccin  -------------------------------AAY-TPL---S------------------
CC1G_10439_Ccin  ------------------------------------------------------------


CC1G_01565_Ccin  ------------------------------------------------------------
CC1G_02101_Ccin  ------------------------------------------------------------
CC1G_02514_Ccin  ------------------------------------------------------------
CC1G_04351_Ccin  ------------------------------------------------------------
CC1G_04368_Ccin  ------------------------------------------------------------
CC1G_04369_Ccin  ------------------------------------------------------------
CC1G_06995_Ccin  --------------A---------A--KA------N---------------------TTG
CC1G_07007_Ccin  ------------------------------------------------------------
CC1G_07017_Ccin  --------------A---------A--RA------K---------------------TTR
CC1G_07297_Ccin  -----------------------------------------------------DA-----
CC1G_09552_Ccin  -----------------PQMTTSFA--PT------K---------------------AQD
CC1G_09560_Ccin  ----------------------------T------V---------------------AKD
CC1G_09643_Ccin  --------------K---------T--PG------YDAQ---------------DPPP--
CC1G_10350_Ccin  ------------------------------------------------------------
CC1G_10359_Ccin  -----------------SQMTTNSF--VT------T---------------------ADM
CC1G_10438_Ccin  ------------------------------------------------------------
CC1G_15125_Ccin  ------------------------------------------------------------
CC1G_12300_Ccin  --------------D---------V--DS------T---------------------TTN
CC1G_13086_Ccin  ----------------------------T------V---------------------AND
CC1G_13585_Ccin  ------------------------------------------------------------
CC1G_15853_Ccin  --------------P---------A--NA------K---------------------TTE
CC1G_14751_Ccin  --------------S---------V--AY------STTM-----------------TVAE
CC1G_02149_Ccin  ------------------------------------------------------------
CC1G_15618_Ccin  ------------------------------------------------------------
CC1G_15846_Ccin  --------------R---------L--PS------STSP---------------HVPKAA
CC1G_15850_Ccin  --------------AV-----------LG------S---------------------VMD
CC1G_02150_Ccin  --------------N---------V--DD------T---------------------TTT
CC1G_07006_Ccin  ------------------------------------------------------------
CC1G_07298_Ccin  --------------S---------TRLVS---------STVAMAPQPLSNELVDK-----
CC1G_08376_Ccin  ------------------------------------------------------------
CC1G_09646_Ccin  ---------------------------HQ---------W------------VIDS-----
CC1G_07441_Ccin  ------------------------------------------------------------
CC1G_09364_Ccin  ------------------------------------------------------------
CC1G_07025_Ccin  ------------------------------------------------------------
CC1G_13267_Ccin  --------------P------------LI------E---------------------ARR
CC1G_09374_Ccin  --------------P------------LI------K---------------------AHR
CC1G_07033_Ccin  ------------------------------------------------------------
CC1G_09362_Ccin  ------------------------------------------------------------
CC1G_07011_Ccin  --------------A---------A--EA------K---------------------TTL
CC1G_06992_Ccin  --------------A---------P--EA------K---------------------ATA
CC1G_09375_Ccin  ------------------------------------------------------------
CC1G_13268_Ccin  ------------------------------------------------------------
CC1G_02099_Ccin  ------------------------------------------------------------
CC1G_15127_Ccin  --------------N---------A--DT------T---------------------TTL
CC1G_07432_Ccin  ------------------------------------------------------------
CC1G_15855_Ccin  ------------------------------------------------------------
CC1G_03062_Ccin  ------------------------------------------------------------
CC1G_03063_Ccin  ------------------------------------------------------------
CC1G_02515_Ccin  ------------------------------------------------------------
CC1G_07020_Ccin  ------------------------------------------------------------
CC1G_10360_Ccin  ------------------------------------------------------------
CC1G_02093_Ccin  ------------------------------------------------------------
CC1G_14491_Ccin  ------------------------------------------------------------
CC1G_12151_Ccin  ------------------------------------------------------------
CC1G_12150_Ccin  ------------------------------------------------------------
CC1G_09618_Ccin  ------------------------------------------------------------
CC1G_09771_Ccin  ----------------------------------------------------------SE
CC1G_02098_Ccin  ------------------------------------------------------------
CC1G_09358_Ccin  ------------------------------------------------------------
CC1G_12699_Ccin  ------------------------------------------------------------
CC1G_15275_Ccin  ------------------------------------------------------------
CC1G_04128_Ccin  ------------------------------------------------------------
CC1G_09382_Ccin  ------------------------------------------------------------
CC1G_07035_Ccin  ------------------------------------------------------------
CC1G_12692_Ccin  ------------------------------------------------------------
CC1G_07032_Ccin  --------------G---------L--NA------T---------------------TTQ
CC1G_07452_Ccin  --------------N---------V--DD------T---------------------TTT
CC1G_07436_Ccin  ------------------------------------------------------------
CC1G_02612_Ccin  -------PNTTN------------S--RTTATDL-Y---------------------SVS
CC1G_07447_Ccin  --------------N---------V--DE------T---------------------TTA
CC1G_15137_Ccin  ------------------------------------------------------------
CC1G_07010_Ccin  --------------A---------A--EA------K---------------------TTK
CC1G_09363_Ccin  ------------------------------------------------------------
CC1G_15136_Ccin  --------------N---------I--DD------T---------------------TTQ
CC1G_12646_Ccin  ------------------------------------------------------------
CC1G_07434_Ccin  ------------------------------------------------------------
CC1G_07019_Ccin  ------------------------------------------------------------
CC1G_07016_Ccin  ------------------------------------------------------------
CC1G_07008_Ccin  ------------------------------------------------------------
CC1G_07022_Ccin  ------------------------------------------------------------
CC1G_07031_Ccin  ------------------------------------------------------------
CC1G_07431_Ccin  ------------------------------------------------------------
CC1G_07024_Ccin  --------------A---------S--EA------K---------------------TTD
CC1G_06991_Ccin  ------------------------------------------------------------
CC1G_15854_Ccin  ------------------------------------------------------------
CC1G_07009_Ccin  ------------------------------------------------------------
CC1G_07435_Ccin  --------------A---------V--DA------K---------------------TKS
CC1G_15120_Ccin  ------------------------------------------------------------
CC1G_15126_Ccin  ------------------------------------------------------------
CC1G_09389_Ccin  ------------------------------------------------------------
CC1G_09368_Ccin  ------------------------------------------------------------
CC1G_08271_Ccin  ------------------------------------------------------------
CC1G_15123_Ccin  ------------------------------------------------------------
CC1G_12693_Ccin  -----------------------------------------------------------D
CC1G_07268_Ccin  ------------------------------------------------------------
CC1G_14317_Ccin  DSNADSLPWVEFGRP---------M--PEETERMKY---------------------RDR
CC1G_14316_Ccin  DSDADSFPWVGFGRP---------M--PEETERLKY---------------------RDR
CC1G_07012_Ccin  ------------------------------------------------------------
CC1G_09460_Ccin  ------------------------------------------------------------
CC1G_02609_Ccin  DSDVDFLPWTEFGCP---------L--SEETRRLRY---------------------REG
CC1G_02100_Ccin  ---------------------------QKDAEEQ-R---------------------KT-
CC1G_02621_Ccin  ------------------------G--DE------K---------------------QTE
CC1G_02216_Ccin  ------------------------------------------------------------
CC1G_02242_Ccin  ------------------------------------------------------------
CC1G_02243_Ccin  ------------------------------------------------------------
CC1G_13589_Ccin  ------------------------------------------------------------
CC1G_04033_Ccin  --------------QEGSALGQQEF--LK------A---------------------VDD
CC1G_09461_Ccin  --------------P-------------Q------P---------------------SKI
CC1G_15619_Ccin  --------------P-------------K------P---------------------SKI
CC1G_09455_Ccin  ------------------------------------------------------------
CC1G_15613_Ccin  ------------------------------------------------------------
CC1G_07207_Ccin  --------------G---------E--EK------K---------------------LVE
CC1G_10437_Ccin  --------------S---------IALVK---------M------------TVDE-----
CC1G_10443_Ccin  ------------------------------------------------------------
CC1G_02608_Ccin  ------------------------------------------------------------
CC1G_02097_Ccin  ---------------------------RSS---G-I---------------------LQ-
CC1G_07425_Ccin  ------------------------------------------------------------
CC1G_11607_Ccin  ------------------------------------------------------------
CC1G_03064_Ccin  ------------------------------------------------------------
CC1G_10358_Ccin  ------------------------------------------------------------
CC1G_11333_Ccin  ------------------------------------------------------------
CC1G_05033_Ccin  --------------AT-----------TP------P---------------------VVQ
CC1G_13269_Ccin  ------------------------------------------------------------
CC1G_07445_Ccin  ------------------------------------------------------------
CC1G_07453_Ccin  ------------------------------------------------------------
CC1G_15248_Ccin  ------------------------------------------------------------
CC1G_05049_Ccin  ------------------------------------------------------------
CC1G_10439_Ccin  ------------------------------------------------------------


CC1G_01565_Ccin  --------------LESD--------------------------D---HSL---------
CC1G_02101_Ccin  -----------------HI--------L--ECG--------------------TM-----
CC1G_02514_Ccin  -----------------------------------------------------AS-----
CC1G_04351_Ccin  --MLL--S----DEVKYHT--------S--LC---------------------AL-----
CC1G_04368_Ccin  --MLL--S----DEVKYHT--------S--LC---------------------AL-----
CC1G_04369_Ccin  VKAAV--V----HDLDGQS--------R--IC---------------------SL-----
CC1G_06995_Ccin  IRYDIA------EAMNSET--------F--VC---------------------DV-----
CC1G_07007_Ccin  ------------------S--------Y--TC---------------------SF-----
CC1G_07017_Ccin  IRYGIA------KAMNSET--------F--LC---------------------DI-----
CC1G_07297_Ccin  VID----------DL---------------------------------------------
CC1G_09552_Ccin  VRDAV--E----SDVRHNI--------R--VC---------------------ER-----
CC1G_09560_Ccin  VEKAV--K----EDLEHNV--------R--VC---------------------EL-----
CC1G_09643_Ccin  ----------------KDFS-------C--PP---------------------SP-----
CC1G_10350_Ccin  -----------------FYHEGVDPSKD--LK---------------------NLRRLKN
CC1G_10359_Ccin  VEEAV--S----QDVEHHT--------W--LC---------------------AT-----
CC1G_10438_Ccin  ------------------------------------------------------------
CC1G_15125_Ccin  ------------------P------------G---------------------DF-----
CC1G_12300_Ccin  MRMDIG------RIMNFEM--------Y--IC---------------------TY-----
CC1G_13086_Ccin  VEKDV--K----KDLEHNV--------R--VC---------------------EL-----
CC1G_13585_Ccin  VKAAV--V----HDLDGQS--------R--IC---------------------SL-----
CC1G_15853_Ccin  LRPDIG------QAMRSEM--------V--AC---------------------DV-----
CC1G_14751_Ccin  QKAIIK------AELAIAT--------V--AS---------------------TD-----
CC1G_02149_Ccin  ------------------------------------------------------------
CC1G_15618_Ccin  ---------------------------L--QC---------------------SY-----
CC1G_15846_Ccin  IYLAAS------NEMSGKFA-------G--PI---------------------DP-----
CC1G_15850_Ccin  QRKAVL------EELDARYRVEANPSFI--LK---------------------AYEKVA-
CC1G_02150_Ccin  LRLDIA------RLMNAEI--------V--LC---------------------DP-----
CC1G_07006_Ccin  ------------------D--------D--Y-----------------------------
CC1G_07298_Ccin  ITA----------NL---------------------------------------------
CC1G_08376_Ccin  -----------------------------------------------------DV-----
CC1G_09646_Ccin  FSSLIQ------R--KGRR--------FDDNG---------------------EV-----
CC1G_07441_Ccin  ------------------V--------S--IC---------------------QA-----
CC1G_09364_Ccin  ------------------I--------S--TC---------------------KS-----
CC1G_07025_Ccin  ------------------V--------S--TC---------------------AF-----
CC1G_13267_Ccin  LRAEIG------DLMNSET--------L--VC---------------------TP-----
CC1G_09374_Ccin  LRVKIA------ELMNSET--------L--VC---------------------TP-----
CC1G_07033_Ccin  ------------------F--------S--TC---------------------QV-----
CC1G_09362_Ccin  ------------------F--------S--TC---------------------QV-----
CC1G_07011_Ccin  IRYEVG------LAMNREI--------F--VC---------------------EV-----
CC1G_06992_Ccin  IGLNIG------SEMNKET--------S--VC---------------------DI-----
CC1G_09375_Ccin  ------------------T--------S--TV---------------------SI-----
CC1G_13268_Ccin  ------------------T--------S--TV---------------------NI-----
CC1G_02099_Ccin  ------------------------------------------------------------
CC1G_15127_Ccin  LRANLG------QFMNAEM--------F--AC---------------------EP-----
CC1G_07432_Ccin  ------------------F--------S--IC---------------------EI-----
CC1G_15855_Ccin  ------------------P--------A--TY---------------------HA-----
CC1G_03062_Ccin  ------------------------------------------------------------
CC1G_03063_Ccin  ------------------------------------------------------------
CC1G_02515_Ccin  -----------------------------------------------------TT-----
CC1G_07020_Ccin  ------------------V--------S--FM---------------------GI-----
CC1G_10360_Ccin  ----------------NHT--------W--VC---------------------TS-----
CC1G_02093_Ccin  ------------------------------------------------------------
CC1G_14491_Ccin  ------------------------------------------------------------
CC1G_12151_Ccin  -----------------------------------------------------QL-----
CC1G_12150_Ccin  ------------------------------FA---------------------PD-----
CC1G_09618_Ccin  -----------------------------------------------------DV-----
CC1G_09771_Ccin  L-------------ATMHFTDEISPLQF--VQ---------------------PKGLGLY
CC1G_02098_Ccin  ------------------------------------------------------------
CC1G_09358_Ccin  ------------------------------------------------------------
CC1G_12699_Ccin  ------------------------------------------------------------
CC1G_15275_Ccin  --------------LQRD--------------------------E---QAL---------
CC1G_04128_Ccin  ------------------------------------------------------------
CC1G_09382_Ccin  ------------------------------------------------------------
CC1G_07035_Ccin  ------------------P--------V--TC---------------------PA-----
CC1G_12692_Ccin  ------------------G--------A--I-----------------------------
CC1G_07032_Ccin  LRGGIA------EVMNSEM--------V--GC---------------------SI-----
CC1G_07452_Ccin  LRIDIA------RLMNLEV--------V--LC---------------------DA-----
CC1G_07436_Ccin  ------------------------------------------------------------
CC1G_02612_Ccin  AESQTGES----YDASAGI--------I--GF---------------------QI-----
CC1G_07447_Ccin  LRIDIA------RLMNLEV--------V--LC---------------------DA-----
CC1G_15137_Ccin  ------------------------------------------------------------
CC1G_07010_Ccin  IRYDIA------GAMNKET--------F--VC---------------------DV-----
CC1G_09363_Ccin  ------------------------------GC---------------------SI-----
CC1G_15136_Ccin  LRLDIA------RLMNSEI--------V--VC---------------------NV-----
CC1G_12646_Ccin  ------------------P--------S--VC---------------------RL-----
CC1G_07434_Ccin  ------------------L--------S--VC---------------------EV-----
CC1G_07019_Ccin  ------------------V--------V--SL---------------------GI-----
CC1G_07016_Ccin  ------------------V--------S--TY---------------------NF-----
CC1G_07008_Ccin  ------------------V--------T--VC---------------------NF-----
CC1G_07022_Ccin  ------------------V--------S--TC---------------------SV-----
CC1G_07031_Ccin  ------------------------------------------------------------
CC1G_07431_Ccin  -----G------DLMNSEM--------Y--VC---------------------TY-----
CC1G_07024_Ccin  IRYDIA------GAMNAET--------F--VC---------------------DV-----
CC1G_06991_Ccin  ------------------V--------S--TC---------------------TV-----
CC1G_15854_Ccin  ------------------V--------P--VS---------------------PI-----
CC1G_07009_Ccin  ------------------I--------P--TC---------------------NF-----
CC1G_07435_Ccin  LRLRIG------QLMNSEI--------I--VC---------------------DA-----
CC1G_15120_Ccin  ------------------F--------Q--SY---------------------GI-----
CC1G_15126_Ccin  ------------------I--------T--NV---------------------GI-----
CC1G_09389_Ccin  ------------------I--------H--TY---------------------HV-----
CC1G_09368_Ccin  ------------------I--------H--TC---------------------HV-----
CC1G_08271_Ccin  ------------------------------------------------------------
CC1G_15123_Ccin  ------------------F--------S--TL---------------------QV-----
CC1G_12693_Ccin  LRPEIG------DAMNSEM--------F--MC---------------------EV-----
CC1G_07268_Ccin  ---------------------------F--QC---------------------SY-----
CC1G_14317_Ccin  VHEQIG------VEMIGEI--------F--VC---------------------PV-----
CC1G_14316_Ccin  VHEQIG------MEMIGET--------F--VC---------------------PV-----
CC1G_07012_Ccin  ------------------V--------S--TC---------------------TV-----
CC1G_09460_Ccin  ---------------------------L--QC---------------------SY-----
CC1G_02609_Ccin  VNERIG------VAMIDET--------F--VC---------------------PF-----
CC1G_02100_Ccin  ------HL----FNVKDHL--------L--QC---------------------DF-----
CC1G_02621_Ccin  IRDRIG------RSMLNEL--------V--TC---------------------PC-----
CC1G_02216_Ccin  -----------------EF--------V--EV---------------------TF-----
CC1G_02242_Ccin  -----------------EI--------V--EV---------------------TF-----
CC1G_02243_Ccin  -----------------EF--------V--EV---------------------TF-----
CC1G_13589_Ccin  VKAEM--TTSSHATTADES--------R--IC---------------------SL-----
CC1G_04033_Ccin  LHVQM--A----REVESNI--------IG-PM---------------------PV-----
CC1G_09461_Ccin  IQLQY--R----LSMEGRI--------I--LC---------------------PY-----
CC1G_15619_Ccin  IQLQY--R----LSMEGRI--------I--LC---------------------PY-----
CC1G_09455_Ccin  ------------------------------------------------------------
CC1G_15613_Ccin  ------------------------------------------------------------
CC1G_07207_Ccin  LRDEIA------QEMDGEF--------V--EV---------------------TF-----
CC1G_10437_Ccin  QKEIIR------IELEGNR--------V--EA---------------------EF-----
CC1G_10443_Ccin  -----------------LYRDEVDPSKD--AE---------------------DFGRLKY
CC1G_02608_Ccin  -----------------ET--------L--KC---------------------SH-----
CC1G_02097_Ccin  ------HT----------------------------------------------------
CC1G_07425_Ccin  ------------------C--------P--RR----------------------------
CC1G_11607_Ccin  ------------------------------------------------------------
CC1G_03064_Ccin  ------------------------------------------------------------
CC1G_10358_Ccin  ------------------------------------------------------------
CC1G_11333_Ccin  ------------TRLDADP--------D--ICKPYVR-------DAQSPIIMAED-----
CC1G_05033_Ccin  ADA----------SL--KLGRTPTPRSS--IS---------------------PL-----
CC1G_13269_Ccin  ------------------I--------H--TC---------------------HV-----
CC1G_07445_Ccin  ------------------L--------S--IC---------------------QI-----
CC1G_07453_Ccin  ------------------L--------I--TC---------------------HA-----
CC1G_15248_Ccin  --------------LESD--------------------------D---HSL---------
CC1G_05049_Ccin  --------------VHID---------D--ASPPFLAKVNLTIGD---PAL---------
CC1G_10439_Ccin  ------------------------------------------------------------


CC1G_01565_Ccin  -------------SLAGSPEFETRDD----------------------------------
CC1G_02101_Ccin  ------------E------------S----------------------------------
CC1G_02514_Ccin  ------------K------------Q----------------------------------
CC1G_04351_Ccin  ------------E------------D----------------------------------
CC1G_04368_Ccin  ------------E------------D----------------------------------
CC1G_04369_Ccin  ------------H------------D----------------------------------
CC1G_06995_Ccin  ------------E------------A----------------------------------
CC1G_07007_Ccin  ------------E------------E----------------------------------
CC1G_07017_Ccin  ------------E------------V----------------------------------
CC1G_07297_Ccin  ------------------------------------------------------------
CC1G_09552_Ccin  ------------Q------------A----------------------------------
CC1G_09560_Ccin  ------------Q------------E----------------------------------
CC1G_09643_Ccin  -----------TK------------P----------------------------------
CC1G_10350_Ccin  ATDLEISAIHAQE------------S----------------------------------
CC1G_10359_Ccin  ------------E------------E----------------------------------
CC1G_10438_Ccin  ------------------------------------------------------------
CC1G_15125_Ccin  ------------E------------LFAAGFVRLLFDRVTEVLCTQALSRVQTIVHLPEA
CC1G_12300_Ccin  ------------N------------Q----------------------------------
CC1G_13086_Ccin  ------------Q------------E----------------------------------
CC1G_13585_Ccin  ------------H------------D----------------------------------
CC1G_15853_Ccin  ------------E------------Y----------------------------------
CC1G_14751_Ccin  ------------E------------D----------------------------------
CC1G_02149_Ccin  ------------------------------------------------------------
CC1G_15618_Ccin  ------------E------------Q----------------------------------
CC1G_15846_Ccin  ------------G------------N----------------------------------
CC1G_15850_Ccin  -T----------------------------------------------------------
CC1G_02150_Ccin  ------------D------------A----------------------------------
CC1G_07006_Ccin  ------------------------------------------------------------
CC1G_07298_Ccin  ------------------------------------------------------------
CC1G_08376_Ccin  ------------V------------G----------------------------------
CC1G_09646_Ccin  -------------------------E----------------------------------
CC1G_07441_Ccin  ------------S------------D----------------------------------
CC1G_09364_Ccin  ------------E------------D----------------------------------
CC1G_07025_Ccin  ------------E------------V----------------------------------
CC1G_13267_Ccin  ------------D------------E----------------------------------
CC1G_09374_Ccin  ------------D------------E----------------------------------
CC1G_07033_Ccin  ------------D------------D----------------------------------
CC1G_09362_Ccin  ------------D------------E----------------------------------
CC1G_07011_Ccin  ------------D------------I----------------------------------
CC1G_06992_Ccin  ------------E------------V----------------------------------
CC1G_09375_Ccin  ------------E------------E----------------------------------
CC1G_13268_Ccin  ------------E------------Q----------------------------------
CC1G_02099_Ccin  ------------------------------------------------------------
CC1G_15127_Ccin  ------------E------------D----------------------------------
CC1G_07432_Ccin  ------------D------------E----------------------------------
CC1G_15855_Ccin  ------------E------------K----------------------------------
CC1G_03062_Ccin  ------------------------------------------------------------
CC1G_03063_Ccin  ------------------------------------------------------------
CC1G_02515_Ccin  ------------D------------E----------------------------------
CC1G_07020_Ccin  ------------T------------D----------------------------------
CC1G_10360_Ccin  ------------T------------D----------------------------------
CC1G_02093_Ccin  ------------------------------------------------------------
CC1G_14491_Ccin  ------------------------------------------------------------
CC1G_12151_Ccin  ------------K------------D----------------------------------
CC1G_12150_Ccin  ------------E------------R----------------------------------
CC1G_09618_Ccin  ------------D-----------------------------------------------
CC1G_09771_Ccin  PMRPMHEAWERDP------------G----------------------------------
CC1G_02098_Ccin  ------------------------------------------------------------
CC1G_09358_Ccin  ------------------------------------------------------------
CC1G_12699_Ccin  ------------------------------------------------------------
CC1G_15275_Ccin  -------------NLTQVPEFNSRDT----------------------------------
CC1G_04128_Ccin  ------------------------------------------------------------
CC1G_09382_Ccin  ------------------------------------------------------------
CC1G_07035_Ccin  ------------E------------E----------------------------------
CC1G_12692_Ccin  ------------------------------------------------------------
CC1G_07032_Ccin  ------------E------------E----------------------------------
CC1G_07452_Ccin  ------------D------------A----------------------------------
CC1G_07436_Ccin  ------------------------------------------------------------
CC1G_02612_Ccin  ------------D------------T----------------------------------
CC1G_07447_Ccin  ------------E------------A----------------------------------
CC1G_15137_Ccin  ------------------------------------------------------------
CC1G_07010_Ccin  ------------E------------I----------------------------------
CC1G_09363_Ccin  ------------E------------E------------------