Protein (view, download) , Domain (view, download)
RON_Hsap        MELLPP----------LPQ--S------------FLLL----------------------
MET_Hsap        MKAPAV----------LAP--G------------ILVL----------------------
MET_Mmus        MKAPTV----------LAP--G------------ILVL----------------------
F11E6.8_Cele    MGLTTL----------PPS--Q------------LRPE----------------------
RON_Mmus        MGLPLP----------LLQ--S---------S--LLLM----------------------
T14E8.1_Cele    MVLGSS----------QSS--A--KELTTQSSIFRFLV----------------------
Met_Spur        MAAFRS----------HLR--V------------LCL-----------------------
AqueK334_Aque   MLLMTE----------DTF--T--NK-----------A----------------------
AqueK335_Aque   MTMINQ----------LNK--S--R----------GLV----------------------
AqueK336_Aque   MISE--------------------------------------------------------
AqueK337_Aque   RLVN--------------------------------------------------------
AqueK338_Aque   MAVNGL----------FLC--L------------Q-L-----------------------
AqueK339_Aque   MDNTTI----------AIC--N--V----------N------------------------
AqueK340_Aque   MDRAQV----------EP------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   MTGLAI----------AV------L------------I----------------------
AqueK343_Aque   MASEET----------EKE--G--DE---------AILQELCTVNGLNYDKLPQGVGLKV
AqueK344_Aque   MLGD--------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   LFYGET------------------------------------------------------
AqueK347_Aque   IWKDVF----------SQS--E--------------------------------------
AqueK348_Aque   MYKGKK----------WKT--Y--SF---------KVT-------G--------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   MYDALC----------SWK--Y--W-----------QE----------------------
AqueK351_Aque   MGSFFT----------KPM--SNVMD-----------E----------------------
AqueK352_Aque   MLYKPI----------LSD--E------------RLPI----------------------
AqueK353_Aque   MIVQSL----------LMA--V--------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   NF----------------------------------------------------------
AqueK356_Aque   MFNQYG----------NDD--L--YS-----------Q----------------------
AqueK357_Aque   MATSAE----------QL------------------------------------------
AqueK358_Aque   MRKATG----------LNP--A--L----------D------------------------
AqueK359_Aque   MEWKAT----------LLS--N--C----------E-L----------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   MPNNFY----------SIA--V--------------------------------------
AqueK362_Aque   MYMDQL----------SDY--I--I----------S-G----------------------
AqueK363_Aque   MQISLK----------AGQ--S--I----------TIQ----------------------
AqueK364_Aque   MEDIHG----------TPH--GN-I----------SVD----------------------
AqueK365_Aque   SLMS--------------------------------------------------------
AqueK366_Aque   MALKTL----------HDG--L--F----------S-E----------------------
AqueK367_Aque   MGGFYR----------TRN--D--P-----------------------------------
AqueK368_Aque   STSVTS----------FTR--N------------IRP-----------------------
AqueK369_Aque   MPIDSD----------N-------------------------------------------
AqueK370_Aque   MQLDYM----------LLA--S--L----------C-G----------------------
AqueK371_Aque   MVPEDD----------FTP--F------------PNT-----------------------
AqueK372_Aque   MIAWRN----------RKK--E--------------LV----------------------
AqueK373_Aque   PDVSAAANGDMALLSFLSA--S--N----------LGL----------------------
AqueK374_Aque   MSFSVF----------SVV--L--L-----------------------------------
AqueK375_Aque   MTPAFF----------LGL--F------------ISA-----------------------
AqueK376_Aque   MGFNTP----------DK------------------------------------------
AqueK377_Aque   MSXXXX----------ARA--I--K----------SIW----------------------
AqueK378_Aque   MEHYLF----------LY------N------------V----------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   MSNNLV----------HVI--T--Y----------A------------------------
AqueK381_Aque   MNDTGI----------IVE--T--VD-----------S----------------------
AqueK382_Aque   IFGD--------------------------------------------------------
AqueK383_Aque   MLGD--------------------------------------------------------
AqueK384_Aque   MAASLL----------LLI--I------------L-------------------------
AqueK385_Aque   ARSRSR----------SRCGSD--F----------C------------------------
AqueK386_Aque   G-----------------------------------------------------------
AqueK387_Aque   TIEE--------------------------------------------------------
AqueK388_Aque   MYNEYG----------VLS--Y--L----------D-V----------------------
AqueK389_Aque   CE----------------------------------------------------------
AqueK390_Aque   MMQLCV----------DLP--W--I----------I-L----------------------
AqueK391_Aque   MIIGNW----------EEE--E--EA---REEMSTLVF----------------------


RON_Hsap        L--LL-PA----------------------------------------------------
MET_Hsap        L--F-TLV----------------------------------------------------
MET_Mmus        L--L-SLV----------------------------------------------------
F11E6.8_Cele    L--EWLFP----------------------------------------------------
RON_Mmus        L--LL-RL----------------------------------------------------
T14E8.1_Cele    L--LLCFT----------------------------------------------------
Met_Spur        L--YAAFF----------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   ---R-TYFDVLDEMLTEYDLMKKPNCIFNMEETGVAMEPHQPRGIFLKRERRPMMLLSGS
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   L--LWYSS----------------------------------------------------
AqueK339_Aque   ---K-EFV----------------------------------------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   C--L-PL-----------------------------------------------------
AqueK343_Aque   KCLE-IF-----------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ST-Y-LH-----------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ---L-SL-----------------------------------------------------
AqueK351_Aque   N--M-KKQQEFQLSAQKMQMERQMMMQVQMRNK---------------------------
AqueK352_Aque   L--VL-IV----------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   T-----------------------------------------------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   S-----------------------------------------------------------
AqueK363_Aque   ---L-QYL----------------------------------------------------
AqueK364_Aque   R--F-KLP----------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   K-----------------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   Y--F-DLV----------------------------------------------------
AqueK371_Aque   R--RTTEE----------------------------------------------------
AqueK372_Aque   --NL-D------------------------------------------------------
AqueK373_Aque   L--L-IYY----------------------------------------------------
AqueK374_Aque   ---F-YFL----------------------------------------------------
AqueK375_Aque   L--LWCLN----------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   --DC-QLL----------------------------------------------------
AqueK378_Aque   C--I--------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   S---------------------HKISVM-GFSD---------------------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ---L-SRS----------------------------------------------------
AqueK385_Aque   Q-----------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   S-IG-QFI----------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   L--L-QLA----------------------------------------------------
AqueK391_Aque   I--L-LL-----------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   KGQFAVVGSVSAAGFCLPPFVIIDHKRFNHAFAEDEVPDESSSFSSLLIVSGDNNTNIRI
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ------------------------------------------------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   ------------------------------------------------------------
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   ------------------------------------------------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   ------------------------------------------------------------
AqueK363_Aque   ------------------------------------------------------------
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ------------------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   ------------------------------------------------------------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   ------------------------------------------------------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ------------------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ---------------------------------------KP-----------A-------
MET_Hsap        ---------------------------------------QR-----------S-------
MET_Mmus        ---------------------------------------QR-----------S-------
F11E6.8_Cele    ---------------------------------------KE-----------V-------
RON_Mmus        ---------------------------------------SA-----------A-------
T14E8.1_Cele    ---------------------------------------SA-----------T-------
Met_Spur        ---------------------------------------SA-----------V-------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   TPTVTVTIPSSLTSSGNQISLNAGQSITIQLQYLETFLLKP-------------------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ---------------------------------------AE-----------Q-------
AqueK339_Aque   ---------------------------------------SV-------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   ----------------------------------------------------G-------
AqueK352_Aque   ---------------------------------------SG-----------I-------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   ------------------------------------------------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   ------------------------------------------------------------
AqueK363_Aque   ----------------------------------ETFLLKP-------------------
AqueK364_Aque   ---------------------------------------SG-------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ------------------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ---------------------------------------PG-------------------
AqueK371_Aque   ---------------------------------------TRTTRSPYPTRSRR-------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ---------------------------------------NG-----------S-------
AqueK374_Aque   ---------------------------------------SP-------------------
AqueK375_Aque   ---------------------------------------VG-----------Q-------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   ----------------------------------------------------GAETSDGF
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ---------------------------------------AG-----------M-------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ---------------------------------------SR-------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ---------------------------------------TL-------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   --------------------------------------IRD-------------------
AqueK335_Aque   ------------------------------------------------------------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ------------------------------------------------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   -----------------------------VAQQLSMAREAFN------------------
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   --------------------------------------SCY-------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   -----------------------------V----AAIVACDTIAAGG-------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   --------------------------------------PAD-------------------
AqueK362_Aque   ------------------------------------------------------------
AqueK363_Aque   ------------------------------------------------------------
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ------------------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   -----------------------------------YGTVCDDEFSMNEVQVLCTEQGFSS
AqueK374_Aque   ------------------------------------------------------------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   TAVPIVDMSNIISIDYQYSVFTAGGKESFI----ATITMCDDLEAE--------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ------------------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        -------------------------A----------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        -------------------------S----------------------------------
T14E8.1_Cele    -------------------------G----------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   ------------------------TV---DKAD-----------------L---------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ------------------------IE---TSAK-----------------V---------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   -------------------------------------WYAGF------------------
AqueK352_Aque   -------------------------L----------------------------------
AqueK353_Aque   ---------------------------------------AAS------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   ---------------------------------ITLGYSNTS------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   -----------------------------------------S------------------
AqueK362_Aque   ---------------------IIQIQETVGQGEFGIVYR-G----VMTSNPQLP-----K
AqueK363_Aque   ------------------------TV---EKAD-----------------L---------
AqueK364_Aque   ---A----------G---------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   --------------SDVWSYGVL-------------CWK-IFSLGK------VPYPGLDP
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ---T----------S---------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   DNGIAVSSEKFVFIQDEFQVYLDTV-----------------------------------
AqueK374_Aque   ------------------------VS---AQSD-----------------CSL--PSQ--
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   -----------------------H-------SD---------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   ---------------------------------------NVT------------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   --------------SYRFVY----------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ---HYTKMGPLRALS---------------------------------SNPH--------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   -----L------------------VAS---------------------------------
AqueK335_Aque   ---------------------------------------------------------TGT
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ---------------------------------------------------------TGA
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   YVTATLGMIAGFAKTKNPAVLSPLIPLTFLVGYQ----------ADMALGNKMERILN--
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   FVKAP-----------S--------PT------T----------D---------AIIN--
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   IPGHYF------------------GTLDQRGLRS----------SQIKFKKYYTPYIP--
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   YYNGT-------------------------------------------------VIIN--
AqueK362_Aque   AVA---------------------VKTL--------------------------------
AqueK363_Aque   ---------------------------------------------------------TGT
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   IGV---------------------VELLDTGGRLQ-------------------CPLNG-
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   --------------------------------------------------SNITHFITGF
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   INATLI------------------SQGTFLPYNG----------STIPFQSHYTSVIT--
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   NGVVTLGHHNGTVSMWTPNMSKPAVKMLCHRGRVSDIAIDREGRYMVTGGFDAKIR----
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   KLES---------------------------------NNPISVYSGHT------------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   VNEA---------------------------------EWVL-LYQGIAR-----------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   ------------------------DA----DKILSNETGL--------------------
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   ------------------------SS---PAGTDVYATQPIGFMIGHT------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   ----------------------------------------------------------KG
AqueK363_Aque   KLES---------------------------------NSPISVYSGHT------------
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ---ACSQEIYSLMMLCWCESPIDRPVFSDLVSLIDNLIEPLAGYLDFTQINNTSLRARSR
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   LIHN---------------------------------DGSV-EYS---------------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   ------------------------GSDDLISSINVIATQPIGFMTGHE------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ---------------V--------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   ----------------------------CV--------------VGSSCDFVGEQIPPVA
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   -----------------GLGNLDTNITACVRDGNNTIDAFKESF----------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   -----------------L---------------------------RLPGQPFFGSLPPRP
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   -----------CL--FYK---------------------------SYYCDYLIEQVPPSY
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   SEDTILQCRHNS----FG-------FHNCGHDE---------------------------
AqueK363_Aque   ----------------------------CV--------------GQFACNSFDEQIPPVA
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   SRCGSDFCQS--------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   ------------------PTIIGSVHYVCQAQGSS--------RGTYRS-----------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   -----------CGQVPID---------------------------QVGCDHLIEQIPPSY
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ------------------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   SWGNEFLVQSFAIYNRQSGYILK-LIGSQANTNANL------------------------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ------------------------------------------------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   TT----------------------------------------------------------
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   TWGYNFLIGPFRSLSMY-STILKFLPSKEIGTNFKI------------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   --------------------------------NVGVHCRSESVTIKDFVDNVTVCDTELD
AqueK363_Aque   SWGNEFLVQSFNNFNFRSGYKLK-LIGSQANTNVNV------------------------
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ---------------------------------------------------------YR-
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   -------------LSIIATYTPN-PGQSQTRGIFQL------------------------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   TWGYNFLTAPFHANN-F-GYILKLFPGKDFGTYFKI------------------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ------------------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ------------------------------------------------------------
AqueK391_Aque   ------------------------------------------------------------


RON_Hsap        ------------------------------------------------------------
MET_Hsap        ------------------------------------------------------------
MET_Mmus        ------------------------------------------------------------
F11E6.8_Cele    ------------------------------------------------------------
RON_Mmus        ------------------------------------------------------------
T14E8.1_Cele    ------------------------------------------------------------
Met_Spur        ------------------------------------------------------------
AqueK334_Aque   ------------------------------------------------------------
AqueK335_Aque   ------LCDEGN------------------------------------------------
AqueK336_Aque   ------------------------------------------------------------
AqueK337_Aque   ------------------------------------------------------------
AqueK338_Aque   ------------------------------------------------------------
AqueK339_Aque   ------------------------------------------------------------
AqueK340_Aque   ------------------------------------------------------------
AqueK341_Aque   ------------------------------------------------------------
AqueK342_Aque   ------------------------------------------------------------
AqueK343_Aque   ------------------------------------------------------------
AqueK344_Aque   ------------------------------------------------------------
AqueK345_Aque   ------------------------------------------------------------
AqueK346_Aque   ------------------------------------------------------------
AqueK347_Aque   ------------------------------------------------------------
AqueK348_Aque   ------------------------------------------------------------
AqueK349_Aque   ------------------------------------------------------------
AqueK350_Aque   ------------------------------------------------------------
AqueK351_Aque   ------------------------------------------------------------
AqueK352_Aque   ------------------------------------------------------------
AqueK353_Aque   ------------------------------------------------------------
AqueK354_Aque   ------------------------------------------------------------
AqueK355_Aque   ------------------------------------------------------------
AqueK356_Aque   ------FCANST------------------------------------------------
AqueK357_Aque   ------------------------------------------------------------
AqueK358_Aque   ------------------------------------------------------------
AqueK359_Aque   ------------------------------------------------------------
AqueK360_Aque   ------------------------------------------------------------
AqueK361_Aque   ------------------------------------------------------------
AqueK362_Aque   DQLLSVMSTNGRCEPYIKRDSKAGICDDFYIPGTDYVYTSNRRLGGSQYLLRQFSERLYE
AqueK363_Aque   ------LCNEGN------------------------------------------------
AqueK364_Aque   ------------------------------------------------------------
AqueK365_Aque   ------------------------------------------------------------
AqueK366_Aque   ------------------------------------------------------------
AqueK367_Aque   ------------------------------------------------------------
AqueK368_Aque   ------------------------------------------------------------
AqueK369_Aque   ------------------------------------------------------------
AqueK370_Aque   ------------------------------------------------------------
AqueK371_Aque   ------------------------------------------------------------
AqueK372_Aque   ------------------------------------------------------------
AqueK373_Aque   ------------------------------------------------------------
AqueK374_Aque   ------MCSSG-------------------------------------------------
AqueK375_Aque   ------------------------------------------------------------
AqueK376_Aque   ------------------------------------------------------------
AqueK377_Aque   ------------------------------------------------------------
AqueK378_Aque   ------------------------------------------------------------
AqueK379_Aque   ------------------------------------------------------------
AqueK380_Aque   ------------------------------------------------------------
AqueK381_Aque   ------FCTVNT------------------------------------------------
AqueK382_Aque   ------------------------------------------------------------
AqueK383_Aque   ------------------------------------------------------------
AqueK384_Aque   ------------------------------------------------------------
AqueK385_Aque   ------------------------------------------------------------
AqueK386_Aque   ------------------------------------------------------------
AqueK387_Aque   ------------------------------------------------------------
AqueK388_Aque   ------------------------------------------------------------
AqueK389_Aque   ------------------------------------------------------------
AqueK390_Aque   ---------------