Protein (view, download) , Domain (view, download)
NDR2_Hsap_NDR                     MAMTAGTT----------------------------------------------------
NDR1_Hsap_NDR                     MAMTGST-----------------------------------------------------
LATS1_Hsap_LATS                   MKRSEKPEG-YR------------------------------------------------
LATS2_Hsap_LATS                   MRPKTFPA----------------------------------------------------
wts_Dmel_LATS                     MHPAGEKRG-GR------------------------------------------------
trc_Dmel_NDR                      MMSSRTQDA-DG------------------------------------------------
NDR2_Mmus_NDR                     MAMTAGAT----------------------------------------------------
NDR1_Mmus_NDR                     MAMTGST-----------------------------------------------------
LATS2_Mmus_LATS                   MRPKTFPA----------------------------------------------------
LATS1_Mmus_LATS                   MKRGEKPEG-YR------------------------------------------------
sax-1_Cele_NDR                    MEIS--------------------------------------------------------
RIM15_Scer_NDR-Unclassified       MFNRSNTAG-GS------------------------------------------------
DBF20_Scer_NDR-Unclassified       MFSRSDREV-DD------------------------------------------------
DBF2_Scer_NDR-Unclassified        MLSKSEKNV-DL------------------------------------------------
CBK1_Scer_NDR                     MYNSSTNHH-EG------------------------------------------------
T20F10.1_Cele_LATS                MRPAAPGTT-P-------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  MEPILIPSQ---------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  MVFSLKESS-DS------------------------------------------------
NdrA_Ddis_NDR-Unclassified        MINDHESVI--D------------------------------------------------
NdrB_Ddis_NDR-Unclassified        MNVERKLES-LS------------------------------------------------
NdrC_Ddis_NDR-Unclassified        MSRKENLNR-SS------------------------------------------------
NdrD_Ddis_NDR-Unclassified        MNQSTQNIF-KMEEEEEDDVDGEIIENNHCINTIIPLHIHSNGLNSIEPILEEVDQNQIS
14389_Tthe                        MSEQIC------------------------------------------------------
18168_Tthe                        MKQESFLQV-KN------------------------------------------------
20817_Tthe                        MIQNQQMQA-GI------------------------------------------------
3690_Tthe                         MNSYLEDSM-LS------------------------------------------------
4868_Tthe                         MQNNQPNQQ-Q-------------------------------------------------
NDR_Spur_NDR                      MAQTQEYG----------------------------------------------------
LATS_Spur_LATS                    MQQYHHQQ----------------------------------------------------
CC1G_01990_Ccin_NDR               MSSRPLPNP-PF------------------------------------------------
CC1G_00855_Ccin_NDR               MNSQGDRTG-T-------------------------------------------------
CC1G_00325_Ccin_NDR               MQGLNTQNI-RK------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  MAALYELIA-VA------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  MAPVSGLPT-KS------------------------------------------------
AqueK010_Aque_LATS                MSSRESKDR--K------------------------------------------------
AqueK011_Aque_LATS                MVKLPPNSS---------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      MDENQRWNG-TQ------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    MEGGKGW--FSR------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      MDPPKSKGWFSW------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    MEGGKGW--FSR------------------------------------------------
GK003_Glam_NDR-Unclassified       MDNDRKQLC-E-------------------------------------------------
GK004_Glam_NDR-Unclassified       MTSDLELDK-D-------------------------------------------------
                                  *

NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ------------------------------------------------------------
LATS2_Hsap_LATS                   ------------------------------------------------------------
wts_Dmel_LATS                     ------------------------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------------------------------------
LATS1_Mmus_LATS                   ------------------------------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        NDNRFNNNNNNNNNNNNNRNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNRKSWIGHLF
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ------------------------------------------------------------
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ------------------------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ------------------------------------------------------------
LATS2_Hsap_LATS                   ------------------------------------------------------------
wts_Dmel_LATS                     ------------------------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------------------------------------
LATS1_Mmus_LATS                   ------------------------------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        VKNKKEKK----------------------------------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ----------------NLLNSHQAISIQELKQ-----------------KGPKNIIDNIQ
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         --------------------SIKMGNLQKIKEVKFGEAGGGNEDDQNDAKSPLNQ-----
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ------------------------------------------------------------
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  -------TDVTDMPVAQ-------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ------------------------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ------------------------------------------------------------
LATS2_Hsap_LATS                   ------------------------------------------------------------
wts_Dmel_LATS                     ------------------------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------------------------------------
LATS1_Mmus_LATS                   ------------------------------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        ------------------------------------------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        YSLSDDDYDDYQEEINYKYAKILQMDQQSIRTNHFLQAPLHTNRQNHRNSYLGKQQNPKP
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         -----------------------------------------------------------I
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ------------------------------------------------------------
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ------------------------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ---------------------------------------QM------------RPKTFPA
LATS2_Hsap_LATS                   ------------------------------------------------------------
wts_Dmel_LATS                     ----------------------------------------------------------PN
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------------------------------------
LATS1_Mmus_LATS                   ---------------------------------------QM------------RPKTFPA
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ---------------------------------------LA------------GN-----
DBF2_Scer_NDR-Unclassified        ---------------------------------------LA------------GN-----
CBK1_Scer_NDR                     ---------------------------------------APTSGHGYYMSQQQDQQH---
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ---------------------------------------IS------------KPSSLKN
NdrA_Ddis_NDR-Unclassified        ---------------------------------------VG---------S-D-------
NdrB_Ddis_NDR-Unclassified        ---------------------------------------LQ---------Q-QQQEE---
NdrC_Ddis_NDR-Unclassified        ----------------------------------------S------------SN-----
NdrD_Ddis_NDR-Unclassified        ---------------------------------------HI------------QPITIEN
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        RSNTPRKTNNNQDDFSKDSENEKATQQNFFQKKKKKPTIKK---------S-QTQEE---
20817_Tthe                        ---------------------------------------QQ---------Q-QQQQT---
3690_Tthe                         ANNISR---------------------------------QT---------R---------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ------------------------------------------------------PSPIPY
CC1G_01990_Ccin_NDR               ----------------------------------------------------QYPQNYWG
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ---------------------------------------TS-----------SRVNI---
CC1G_14606_Ccin_NDR-Unclassified  ---------------------------------------LM-----------NNPKICES
CC1G_13618_Ccin_NDR-Unclassified  ---------------------------------------T--------------------
AqueK010_Aque_LATS                ---------------------------------------VR------------KPAVGSS
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ---------------------------------------LN-----------AYNTV---
NDR1_a-1_Smoe_NDR-Unclassified    ---------------------------------------FH-----------AQPKV---
NDR1_b_Smoe_NDR-Unclassified      ---------------------------------------FS-----------KKKKV---
NDR1_a-2_Smoe_NDR-Unclassified    ---------------------------------------FH-----------AQPKV---
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   S-NYTVSSRQM--LQ---------------------------------------------
LATS2_Hsap_LATS                   T-TYSGNSRQR--LQ---------------------------------------------
wts_Dmel_LATS                     D-KYTA---EA--LE---------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   T-TYSGNSRQR--LQ---------------------------------------------
LATS1_Mmus_LATS                   S-NYPGSSRQM--LQ---------------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       --------Q---------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ----NGASSDI--RH---------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  S-----------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ----------S--IE---------------------------------------------
NdrD_Ddis_NDR-Unclassified        N-NNSSSDDSY--LS---------------------------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    D-EESGAKVSQ--IS---------------------------------------------
CC1G_01990_Ccin_NDR               P-VY-GDSRNNHHYQDQYHNPYG-------------YPN---------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  --IV----Q---RVQN-----IGRAWDDHPDWPGRNWYVQVLLAVASLSRVVEWWEAEKQ
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                SQSSTAGNEQV--LQ---------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ------------------------------EIR-ESL-RN-L-------------SKPS-
LATS2_Hsap_LATS                   ------------------------------EIR-EGL-KQ-P-------------SKSSV
wts_Dmel_LATS                     ------------------------------SIK-QDL-TR-F----------------EV
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------EIR-EGL-KQ-P-------------SKAST
LATS1_Mmus_LATS                   ------------------------------EIR-ESL-RN-L-------------SKPS-
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------AMK-EGL-G---------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------QR---GV-APIP-------------FG-S-
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------FNR---------------------------
NdrD_Ddis_NDR-Unclassified        ------------------------------ENISSGSSNGMDNSSSGSSSSGSSSGSS--
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ------------------------------RLY--------------------------Q
CC1G_01990_Ccin_NDR               --------YAHQPPD-FDEQPATSSIPVGTLLH-KGFYDL-L-------------AMIPT
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  FWNFDDNNDEHDEPLMFVMKPADEDVSNLDLEL-EGF-RL-D-------------DKP--
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ------------------------------GIR-VNL-AA-S-------------RK---
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ---------------D--AA--K-AEH--------------------------NMSKMST
LATS2_Hsap_LATS                   QGLPAGPNS------D--TS-LD-AKV--------------------------LGSKDAT
wts_Dmel_LATS                     Q-----------------------------------------------------NNHRNN
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   QGLLVGPNS------D--TS-LD-AKV--------------------------LGSKDAS
LATS1_Mmus_LATS                   ---------------D--AS--K-AEH--------------------------NLNKMST
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ---------------------------MSHLGFYDLNIPK--PT----------------
DBF2_Scer_NDR-Unclassified        ---------------------------MSNLSFDGHGTPGGTGL----------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                --------T------N--SA-ID-AHH--------------------------N------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------TIIEN-PEILNNNNN-------N-NNSN-NI-----------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------DRDRD-SSNISNSSN----INCN-NSSQTPPIPQHNSLSGRS
NdrD_Ddis_NDR-Unclassified        --SSSSSTNTSAYTSPNTNSTTN-TPT-------------S-SNNN-TP-----------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    QQQPKGPDS------P--DSSIRDGSSY-------------------------ASS----
CC1G_01990_Ccin_NDR               PSPSRLIWGSPPSPNK--SS-----------------------------------DLQAG
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  PSPGLSR--KPT---A--EAPFV-APAP---------------------------EGDAG
CC1G_13618_Ccin_NDR-Unclassified  ----------------------------SN-------LPGS-PTKQV---------SG--
AqueK010_Aque_LATS                -SVTPSPVRETATPSP--VTLVE-SSS--------------------------PGSSRVK
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   EDPR--------Q------VR-----------NPP-K-----------------------
LATS2_Hsap_LATS                   RQQQ--------Q------MR-----------ATP-K-----------------------
wts_Dmel_LATS                     QNYT--------P------LR-----------YTA-T-----------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   R-QQ--------Q------MR-----------ATP-K-----------------------
LATS1_Mmus_LATS                   EDPR--------Q------VR-----------NPP-K-----------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------I------NKLSP------------------------------------
DBF20_Scer_NDR-Unclassified       ---S--------P-----------------------------------------------
DBF2_Scer_NDR-Unclassified        ---F--------P-----------------------------------------------
CBK1_Scer_NDR                     --QQ--------Q------QQ---------------------------------------
T20F10.1_Cele_LATS                --------------------------------SEI-R-----------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  -IKS--------PN----------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ---Q--------Q------DE---------------------------------------
NdrC_Ddis_NDR-Unclassified        KHSS--------PI------H-----------SLK-K-----------------------
NdrD_Ddis_NDR-Unclassified        -LST--------PS------N-----------STR-KKFIQNFLSIFSKSDDNRNHSTNG
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ---Q--------Q------I----------------------------------------
20817_Tthe                        ---Q--------Q------QQ---------------------------------------
3690_Tthe                         --------------------Q---------------------------------------
4868_Tthe                         --------------------Q---------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    TDSS--------SLSNGSGYR-----------TVPAP-----------------------
CC1G_01990_Ccin_NDR               PRYEEIVPPANAA------IKATPKKGRRVSKDMVSK-----------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               --NQ--------S------RQ---------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  STS---------S------ERLTP------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ---L--------P-----------------------------------------------
AqueK010_Aque_LATS                SRPS--------P------VE-----------SER-Q-----------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      --------------------V---------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    --------------------E---------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ---K--------P------EE---------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    --------------------E---------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ---------------------------------------FGTH-HKALQEIRNSLLPFA-
LATS2_Hsap_LATS                   ---------------------------------------FGPY-QKALREIRYSLLPFA-
wts_Dmel_LATS                     ---------------------------------------NGRN-DALTPDYHHAKQPME-
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ---------------------------------------FGPY-QKALREIRYSLLPFA-
LATS1_Mmus_LATS                   ---------------------------------------FGTH-HKALQEIRNSLLPFA-
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     --------------------------------------------------YANEMN----
T20F10.1_Cele_LATS                ---------------------------------------VGRH-RAKLDEIRESLKAYE-
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ---------------------------------------FLLS-QKQ-RS----------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ---------------------------------------KGSLVRQGIEDLFSSLSVDT-
NdrD_Ddis_NDR-Unclassified        NSNQSQNIHHLSLNNGNLTNINNNNNNGNNNNNNNSECHIRER-HKTLSKFWKKRTPFV-
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ---------------------------------------HGFK-RKSSYDDRGQPLLQSN
CC1G_01990_Ccin_NDR               ---------------------------------------PTGF-----------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ---------------------------------------RHRH-GEQMARIRDNLKPHH-
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   -------------NE-----------TN----------------SSR-------------
LATS2_Hsap_LATS                   -------------NE-----------SG----------------TSA-------------
wts_Dmel_LATS                     -------------PP-----------PS----------------ASP-------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   -------------NE-----------SG----------------TSA-------------
LATS1_Mmus_LATS                   -------------NE-----------TS----------------SSR-------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ----------PY------------------------------------------------
T20F10.1_Cele_LATS                -------------HE-----------AGLLSSHVALGSLATPSSSSV-------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        -------------HS-----------SS----------------NSN-------------
NdrD_Ddis_NDR-Unclassified        -------------HS-----------PS------------------NYHIVDNKHHRNHK
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    AAGDALQHPSPYGQQTSRQQIHLGGGSD----------------NTR-------------
CC1G_01990_Ccin_NDR               ---------------------------------------------VH-------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ------------KSD-----------PG----------------FNY-------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   -STSEVNPQMLQ--DLQ-AAGFDEDMVIQALQKTNN------------------------
LATS2_Hsap_LATS                   --AAEVNRQMLQ--ELV-NAGCDQEMAGRALKQTGS------------------------
wts_Dmel_LATS                     -AP-DVVIPPPP--A--------------IVGQPGA------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   --AAEVNRQMLQ--ELV-NAGCDQEMAGRALKQTGS------------------------
LATS1_Mmus_LATS                   -SPSEVNPQMFQ--DLQ-AAGFDEDMVIQALQKTNN------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       -------QA---------------------------------------------------
DBF2_Scer_NDR-Unclassified        -------NQNI-------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                -SHSD-------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  --INISNEQTQR--ELN-NNGGNL-DH------RDPNSPKYLTSSHSSVVIPQDNSNNNN
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        -NNSSSNN----------------------NNNNNN------------------------
NdrD_Ddis_NDR-Unclassified        RSS--------SSSQLANSVSCDQ-LNIKYISTKHE------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    -SLSSIS-----------------------------------------------------
CC1G_01990_Ccin_NDR               -LVHASDADQYE--ALL-T-----------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  -------EQQS-------------------------------------------------
AqueK010_Aque_LATS                -PPDAVDQDMLH--ELI-MKGYDQNSCIAALIQCNS------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   -----RSIEAAIEFISKMSYQDP-------------------------------------
LATS2_Hsap_LATS                   -----RSIEAALEYISKMGYLDP-------------------------------------
wts_Dmel_LATS                     -----GSISVSGVGVGVVGVANG-------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   -----RSIEAALEYISKMGYLDP-------------------------------------
LATS1_Mmus_LATS                   -----RSIEAAVEFISKMSYQDP-------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ---T--------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ----------------------ITNDNAEVMNFSSSSSNAAATTTTVSSAAVSNSNSFRT
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  NNNIRISTSPILTEISENGLLES-------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        -----HNINSSSE-----------------------------------------------
NdrD_Ddis_NDR-Unclassified        -----RSSKSSSMALRKMMYNDL-------------------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ---------------SNNSFSDG-------------------------------------
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ---FYKD-----------------------------------------------------
AqueK010_Aque_LATS                -----HSVEAALDVLMS-------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   -----------RRE----------------------------------------QMAAA-
LATS2_Hsap_LATS                   -----------RNE----------------------------------------QIVR--
wts_Dmel_LATS                     -----------RVP----------------------------------------KMM---
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   -----------RNE----------------------------------------QIVR--
LATS1_Mmus_LATS                   -----------RRE----------------------------------------QMSAA-
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ---------------------------QYRPARKSENGRL--------------------
DBF2_Scer_NDR-Unclassified        -----------------------KR--RTRPAGI--NDSP--------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                EGGGHKMRITPM------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  -----------PTSPIRT---------SSTP-----------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ---------------------------SSTP-----------------------------
NdrD_Ddis_NDR-Unclassified        -----------FENLIHQQQLQLQQQQQQQPQQQ-----IDNIPENNINININTNVNLNV
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    -----------RSS----------------------------------------SIQ---
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ---------------IH------METAKGAPTMSSYNDV---------------------
AqueK010_Aque_LATS                ---------------------------------------------------------GK-
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ---------------------------------------------------AARPINA-S
LATS2_Hsap_LATS                   ------------------------------------------------------VIKQTS
wts_Dmel_LATS                     ------------------------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------------------------------------------------------VIKQTS
LATS1_Mmus_LATS                   ---------------------------------------------------AARPINA-T
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        NNNNNNNNNNNNNNNNNINGDDFLRNNIIHNSNDSEQQFELNHNSIINNVNK--------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    -----------------------------------------------------QQQQAAY
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                ---------------------------------------------------RSTPIST-T
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   MKPGNVQQSV--------------------------------------------------
LATS2_Hsap_LATS                   PGKGLMPTPV--------------------------------------------------
wts_Dmel_LATS                     --TALMPNKL--------------------------------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   PGKGLAPTPV--------------------------------------------------
LATS1_Mmus_LATS                   MKPGNVQHSI--------------------------------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     ------------------------------------------------------------
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        ------------------------------------------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         ------------------------------------------------------------
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    PGRSYTSIMAAGDNLAPNSQGMPFAGSVAPGGDSRLQTQWNTMNYSGYPAHSRDSSGQIH
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------------------------------------
CC1G_13618_Ccin_NDR-Unclassified  ------------------------------------------------------------
AqueK010_Aque_LATS                SS----------------------------------------------------------
AqueK011_Aque_LATS                ------------------------------------------------------------
NDR1_c_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-1_Smoe_NDR-Unclassified    ------------------------------------------------------------
NDR1_b_Smoe_NDR-Unclassified      ------------------------------------------------------------
NDR1_a-2_Smoe_NDR-Unclassified    ------------------------------------------------------------
GK003_Glam_NDR-Unclassified       ------------------------------------------------------------
GK004_Glam_NDR-Unclassified       ------------------------------------------------------------


NDR2_Hsap_NDR                     ------------------------------------------------------------
NDR1_Hsap_NDR                     ------------------------------------------------------------
LATS1_Hsap_LATS                   ------N-----------RKQS---WKGSKESL---------------------------
LATS2_Hsap_LATS                   ------T-----------RRPS---FEGTGDSF---------------------------
wts_Dmel_LATS                     ------I-----------RKPS---IERDTASS---------------------------
trc_Dmel_NDR                      ------------------------------------------------------------
NDR2_Mmus_NDR                     ------------------------------------------------------------
NDR1_Mmus_NDR                     ------------------------------------------------------------
LATS2_Mmus_LATS                   ------T-----------RRPS---FEGTGEAL---------------------------
LATS1_Mmus_LATS                   ------N-----------RKQS---WKGSKESL---------------------------
sax-1_Cele_NDR                    ------------------------------------------------------------
RIM15_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF20_Scer_NDR-Unclassified       ------------------------------------------------------------
DBF2_Scer_NDR-Unclassified        ------------------------------------------------------------
CBK1_Scer_NDR                     -----------------------------------------------QQIPRPPAAGFSS
T20F10.1_Cele_LATS                ------------------------------------------------------------
DDB0216387_Ddis_NDR-Unclassified  ------------------------------------------------------------
DDB0231558_Ddis_NDR-Unclassified  ------------------------------------------------------------
NdrA_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrB_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrC_Ddis_NDR-Unclassified        ------------------------------------------------------------
NdrD_Ddis_NDR-Unclassified        -------------------SISTNNIKNSNENLI--------------------------
14389_Tthe                        ------------------------------------------------------------
18168_Tthe                        ------------------------------------------------------------
20817_Tthe                        ------------------------------------------------------------
3690_Tthe                         --------------------------------------------------AESEVEDDGS
4868_Tthe                         ------------------------------------------------------------
NDR_Spur_NDR                      ------------------------------------------------------------
LATS_Spur_LATS                    ITAGRAPPNNLQSTNHNRSVPS---MERTKVANMLHIGNNGDIYQSYV------------
CC1G_01990_Ccin_NDR               ------------------------------------------------------------
CC1G_00855_Ccin_NDR               ------------------------------------------------------------
CC1G_00325_Ccin_NDR               ------------------------------------------------------------
CC1G_14606_Ccin_NDR-Unclassified  ------------------------------