Protein (view, download) , Domain (view, download)
PKR_Hsap_PKR                      FK-EIELIGSGG-FGQ--VFK-AKHRIDGKTYVIKR-------------------V-KYN
PEK_Hsap_PEK                      FE-PIQCLGRGG-FGV--VFE-AKNKVDDCNYAIKR-------------------I-RLP
HRI_Hsap_HRI                      FE-ELAILGKGG-YGR--VYK-VRNKLDGQYYAIKK-------------------I-LIK
GCN2_Hsap_GCN2                    FE-ELQLLGKGA-FGA--VIK-VQNKLDGCCYAVKR-------------------I-PIN
GCN2~b_Hsap_GCN2                  VH-KGKCIGSDEQLGK-LVYN-ALETATGGFVLLYEWVLQWQKK-MGPFLTSQEKE-K--
Gcn2_Dmel_GCN2                    IQ-RGCCVGHSQ-RGC--IAYTGIDMHCGQLLYITE-------------------W-NIK
Gcn2~b_Dmel_GCN2                  FE-VLMYLGKGA-FGD--VLK-VRNILDNREYAIKR-------------------I-PLP
PEK_Dmel_PEK                      FE-LMQCLGRGG-FGV--VFE-AKNKLDENRYAIKR-------------------I-TLP
PKR_Mmus_PKR                      FE-DIEEIGLGG-FGQ--VFK-AKHRIDGKRYAIKR-------------------V-KYN
PEK_Mmus_PEK                      FE-PIQCMGRGG-FGV--VFE-AKNKVDDCNYAIKR-------------------I-RLP
HRI_Mmus_HRI                      FE-ELAILGKGG-YGR--VYK-VRNKLDGQHYAIKK-------------------I-LIK
GCN2_Mmus_GCN2                    FE-ELQLLGKGA-FGA--VIK-VQNKLDGCCYAVKR-------------------I-PIN
GCN2~b_Mmus_GCN2                  VH-KGRCVGSDEQLGK-VVYN-ALETATGSFVLLHEWVLQ-WQK-MGPCLTSQEKE-K--
pek-1_Cele_PEK                    FE-VKKVIGHGG-FGV--VFR-AQSITDMNEYAVKR-------------------I-AVA
GCN2_Scer_GCN2                    FE-EIAVLGQGA-FGQ--VVK-ARNALDSRYYAIKK-------------------I-RHT
Y38E10A.8_Cele_PEK                YD-VVDVLGQGS-FGI--VFQ-AQRKNDRELRAVKR-------------------L-DLD
Y81G3A.3_Cele_GCN2                NV-IIRVLGRGG-FGD--VVL-VRNKMDSTDYAIKR-------------------I-PLN
DDB0216407_Ddis_GCN2              FE-EIQLLGRGG-FGQ--VVK-VRNKLDGRYYAIKK-------------------I-KLD
DDB0219793e_Ddis_PEK              FC-EIEKVGKGG-YGS--VFK-VKNKLDGEYYALKK-------------------I-PFK
DDB0220652_Ddis_PEK-Unclassified  FN-DVRVLGKGG-FGI--VFQ-CCNIFDQMEYAVKR-------------------I-KVN
DDB0229432_Ddis_PEK               FK-EISKLGSGG-FGS--VYL-SEYVLDGHKYAIKK-------------------V-NFS
IfkB_Ddis_GCN2                    EQ-SSSDSENGE-NGM--KSR------------------------------------IIE
11434_Tthe_GCN2                   FR-VIDELGRGG-FGR--VYK-VQSMVEEKIYAIKK-------------------I-AVP
18670_Tthe_GCN2                   FE-EVEQIGKGG-FGQ--VYK-VKNRLDSLNYAVKK-------------------I-KLD
21870_Tthe_GCN2                   FE-EIQVLGQGA-FGQ--VVK-VRNKLDGRYYAIKK-------------------I-KIR
6287_Tthe_PEK-Unclassified        FI-QLQKIGQGG-FAS--VYR-VVHKIDDTEYAVKQ-------------------I-HLK
GCN2_Spur_GCN2                    FE-FLAFLGKGG-FGN--VIK-VRNKLDGNLYAIKK-------------------I-LLN
GCN2~b_Spur_GCN2                  VH-KGILLGSNP-EGS-SVYA-GMDAHSGDLLTIREWVIK-WKQGKGRKPLPDEEE-D--
PEK_Spur_PEK                      FE-HTECLGKGG-FGI--VFR-AKNKVDENNYAVKR-------------------I-TLP
HRI_Spur_HRI                      FI-QKEPIGEGG-FGK--VYK-VQHKLDKEHYAIKK-------------------I-KVT
CC1G_02807_Ccin_GCN2              WE-ELELLGKGA-FGS--VVK-ARNKVDNRVYAVKK-------------------V-RLK
AqueK195_Aque_GCN2                FE-VLEVLGKGG-FGD--VIK-VRNYLDSRLYAIKK-------------------V-RLT
AqueK195~b_Aque_GCN2              NILRGKLLGDSS-HGYYSVYC-GMEVDSGSLVCIYEWIIP-CKTQKKADTRRSRQAGGAG
AqueK194_Aque_GCN2                FE-VLEVLGKGG-FGD--VIK-VRNYLDSRLYAIKK-------------------V-RLT
AqueK194~b_Aque_GCN2              NILRGKLLGDSS-HGYYSVYC-GMEVDTGSLVCVYEWIIP-CKTQKKADTRRSRQA-GAG
AqueK193_Aque_GCN2                FE-EIKLLGKGA-FGE--VYH-VKHNLDKKEYAMKI-------------------I-PAN
AqueK196_Aque_PEK                 FE-KLGMLGKGG-FGV--VYH-VLHKVDKGKYAIKM-------------------I-PTT
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 -----------------------------------------------------------x
PEKc_Smoe_GCN2                    FE-ELCLLGKGG-FGH--VVL-CKNKLDGRRYAMKK-------------------V-KLK
PEKa_Smoe_GCN2                    FE-ELCLLGKGG-FGH--VVL-CKNKLDGRRYAMKK-------------------V-KLK
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_t_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEKb_Smoe_PEK-Unclassified        YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_u_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_a_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_b_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_c_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_d_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_e_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_f_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_g_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_h_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_i_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_j_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_k_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_l_Smoe_PEK-Unclassified    ------CVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_m_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_n_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_o_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_p_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_q_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
PEK-S1_s_Smoe_PEK-Unclassified    YE-VLACVGQGA-SGK--VYK-CRSKEDEQIYAIKV-------------------I-KVR
GK065_Glam_GCN2                   FV-ELYQLGKGG-YGE--VVC-ANRLMENQKYAVKK-------------------V-VID


PKR_Hsap_PKR                      NE--------------------------------K-------------------------
PEK_Hsap_PEK                      NRELA---------------------------REK-------------------------
HRI_Hsap_HRI                      GATK-------------------------TV-CMK-------------------------
GCN2_Hsap_GCN2                    PASR-------------------------Q--FRR-------------------------
GCN2~b_Hsap_GCN2                  -I-DK----------------------CKKQ-IQG-------------------------
Gcn2_Dmel_GCN2                    YSQLEQPCIGGGKCHWSSESKCMGSHRVDEV-MAS-------------------------
Gcn2~b_Dmel_GCN2                  ARSR-------------------------QL-YKK-------------------------
PEK_Dmel_PEK                      NKESS---------------------------RQR-------------------------
PKR_Mmus_PKR                      TE--------------------------------K-------------------------
PEK_Mmus_PEK                      NRELA---------------------------REK-------------------------
HRI_Mmus_HRI                      SATK-------------------------TD-CMK-------------------------
GCN2_Mmus_GCN2                    PASR-------------------------H--FRR-------------------------
GCN2~b_Mmus_GCN2                  -I-DK----------------------CKRQ-IQG-------------------------
pek-1_Cele_PEK                    DNDKA---------------------------RNR-------------------------
GCN2_Scer_GCN2                    --EE-------------------------K--LST-------------------------
Y38E10A.8_Cele_PEK                SATLP-----------------------------R-------------------------
Y81G3A.3_Cele_GCN2                AKSDK-------------------------L-NRK-------------------------
DDB0216407_Ddis_GCN2              SNQS-------------------------L--NRR-------------------------
DDB0219793e_Ddis_PEK              NTTK-------------------------TF-LEK-------------------------
DDB0220652_Ddis_PEK-Unclassified  QKI-------------------------P----TK-------------------------
DDB0229432_Ddis_PEK               ISNNQ------------------SPTNASSK-IEK-------------------------
IfkB_Ddis_GCN2                    NASD-------------------------SYSDDDNNNNNDSNNNYHSDNESDSFSGSIS
11434_Tthe_GCN2                   YDGFS-----------------------NPK-EHK-------------------------
18670_Tthe_GCN2                   INQKE-------------------------L-TKK-------------------------
21870_Tthe_GCN2                   KGQ--------------------------N--IEK-------------------------
6287_Tthe_PEK-Unclassified        IKDIK--------------------EDLQKH-YEK-------------------------
GCN2_Spur_GCN2                    PKSR-------------------------EL-NKK-------------------------
GCN2~b_Spur_GCN2                  -A-EA----------------------CLKQ-CAS-------------------------
PEK_Spur_PEK                      NREEA---------------------------RDK-------------------------
HRI_Spur_HRI                      KRK-------------------------SCS-LQS-------------------------
CC1G_02807_Ccin_GCN2              AVQK----------------------------DDK-------------------------
AqueK195_Aque_GCN2                GGSK-------------------------M--MTK-------------------------
AqueK195~b_Aque_GCN2              SVGRS----------------------EGNL-VAS-------------------------
AqueK194_Aque_GCN2                GGSK-------------------------M--MTK-------------------------
AqueK194~b_Aque_GCN2              SVGRS----------------------EGNL-VAS-------------------------
AqueK193_Aque_GCN2                K---I---------------------------NQK-------------------------
AqueK196_Aque_PEK                 --------------------------------SGK-------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 --------------------------------SGK-------------------------
PEKc_Smoe_GCN2                    DENP----------------------------SDK-------------------------
PEKa_Smoe_GCN2                    DENP----------------------------SDK-------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_t_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEKb_Smoe_PEK-Unclassified        TATKS----------------------RDQD-VAL-------------------------
PEK-S1_u_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_a_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_b_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_c_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_d_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_e_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_f_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_g_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_h_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_i_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_j_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_k_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_l_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_m_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_n_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_o_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_p_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_q_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
PEK-S1_s_Smoe_PEK-Unclassified    TATKS----------------------RDQD-VAL-------------------------
GK065_Glam_GCN2                   RRDFH--------------AKTESVGGFLQY-IKS-------------------------


PKR_Hsap_PKR                      -AEREVKALA--KL-DHVNIVHYNG-CWDGFDYDPETS----------------------
PEK_Hsap_PEK                      -VMREVKALA--KL-EHPGIVRYFN-AWLEAPPEKWQEKMDEI-----------------
HRI_Hsap_HRI                      -VLREVKVLA--GL-QHPNIVGYHT-AWIEHVHVIQPRA-DRA-----------------
GCN2_Hsap_GCN2                    -IKGEVTLLS--RL-HHENIVRYYN-AWIERHERPAGPGTPPP-----------------
GCN2~b_Hsap_GCN2                  -TETEFNSLV--KL-SHPNVVRYLA-MNLKEQDDS-------------------------
Gcn2_Dmel_GCN2                    -IEKQVSSLS--QL-QHKNLVSYEC-VLCIKRKE--------------------------
Gcn2~b_Dmel_GCN2                  -MTREVELLS--RL-NHENVVRYFN-SWIESV----------------------------
PEK_Dmel_PEK                      -VLREARTLA--SC-EHHNIVRYFH-SWTETPPT--------------------------
PKR_Mmus_PKR                      -AEHEVQALA--EL-NHVNIVQYHS-CWEGVDYDPEHS----------------------
PEK_Mmus_PEK                      -VMREVKALA--KL-EHPGIVRYFN-AWLETPPEKWQEEMDEI-----------------
HRI_Mmus_HRI                      -VLREVKVLA--GL-QHPNIVGYHT-AWIEHVHVVQPQD--RV-----------------
GCN2_Mmus_GCN2                    -IKGEVTLLS--RL-HHENIVRYYN-AWIERHERPAVPGTPPP-----------------
GCN2~b_Mmus_GCN2                  -AETEFSSLV--KL-SHPNIVRYFA-MNSREEEDS-------------------------
pek-1_Cele_PEK                    -VLREARALA--MF-DHPGIIRYFY-AWEERPPKGFQEKEDEN-----------------
GCN2_Scer_GCN2                    -ILSEVMLLA--SL-NHQYVVRYYA-AWLEED----------------------------
Y38E10A.8_Cele_PEK                -AAREVTTIT--SIGRHSGYIFFDEVFWKEHKT---------------------------
Y81G3A.3_Cele_GCN2                -IAKEAKFFA--KL-NHPNMVRYYY-AWAEDLIPIVEETSDD-D----------------
DDB0216407_Ddis_GCN2              -ILREVITLS--RL-HHQHVVRYYQ-AWIESAESLSLTN-DNS-----------------
DDB0219793e_Ddis_PEK              -VLREVKTLA--SL-NHRNIVRYHS-AWLETEELLP-PSSS-M-ASTSLSTSNGKQIDSD
DDB0220652_Ddis_PEK-Unclassified  -ELMEVRAMA--RL-NHPNIVRYYG-SWIEEEIITNNSI---------------------
DDB0229432_Ddis_PEK               -VVREVVALA--KL-DHINILRYHN-AWLELDPKNNKPRSSSF-SSVE------------
IfkB_Ddis_GCN2                    MSDGNGSGYE--AT-DDEDIINNSG-SFDD------------------------------
11434_Tthe_GCN2                   -YFREVKSIM--SL-NHINIVRYHT-SWWENCDDEMVNQVNEF-----------------
18670_Tthe_GCN2                   -TLKEVKLLS--IL-QHNHIVRYYQ-AWLEKPDEKTLQEFENSEE---------------
21870_Tthe_GCN2                   -LMREVTLLS--RL-HHRHVLRYYQ-AWLEESNQSEEEESM-------------------
6287_Tthe_PEK-Unclassified        -LIREARYLA--QV-NHPNVIRYFH-SWIEVTEKKKSQKQEEQ-KRQ-------------
GCN2_Spur_GCN2                    -ITREVKLLS--RL-NHENVVRYYN-SWIEVAEEPPTTDTDES-----------------
GCN2~b_Spur_GCN2                  -VEQELLSLL--RL-EHANIVHYLA-MNYNKGKED-------------------------
PEK_Spur_PEK                      -VLREARTLA--IL-DHSGIVRYFN-SWLEEPPLGWQDIQDKK-----------------
HRI_Spur_HRI                      -MQREIKTLA--CL-DHHNIVRYHQ-SWFGEEVQLLSQQRLML-GLGSFT-DMG------
CC1G_02807_Ccin_GCN2              -IMREVNALS--RL-NHRFIVRYYT-TWIETTEAPSTTVSDDS-----------------
AqueK195_Aque_GCN2                -LTREVELLS--QM-NHENIVRYYN-AWIEKYSEPNHHGNEEE-----------------
AqueK195~b_Aque_GCN2              -IRQEYDSFSERFI-NHSSIVKYLL-MRHNLTEHG-------------------------
AqueK194_Aque_GCN2                -LTREVELLS--QM-NHENIVRYYN-AWIEKYSEPNHHGNEEE-----------------
AqueK194~b_Aque_GCN2              -IRQEYDSFSERFI-SHSSIVKYLL-MRHNLTEHG-------------------------
AqueK193_Aque_GCN2                -DLREVLALS--DF-KHSGIVQYYC-SFID------------------------------
AqueK196_Aque_PEK                 -VKREVHALS--VL-YHPGIVRYYN-SFIDCAPVGWDDD-D-------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 -VKREVHALS--VL-YHPGIVRYYN-SFIDCAPVGWDDN---------------------
PEKc_Smoe_GCN2                    -ILREVATLS--RL-QHQHVVRYYQ-AWFETAAGGSSGT-PY------------------
PEKa_Smoe_GCN2                    -ILREVATLS--RL-QHQHVVRYYQ-AWFETAAGGSSGT-PY------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    -VFKEGEMFQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_t_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEKb_Smoe_PEK-Unclassified        -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_u_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_a_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_b_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFN-MWKEEGEPG-------------------------
PEK-S1_c_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFN-MWKEEGEPG-------------------------
PEK-S1_d_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFN-MWKEEGEPG-------------------------
PEK-S1_e_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_f_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_g_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_h_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVEYFD-MWKEEGEPG-------------------------
PEK-S1_i_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVEYFD-MWKEEGEPG-------------------------
PEK-S1_j_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_k_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFN-MWKEEGEPG-------------------------
PEK-S1_l_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_m_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_n_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_o_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_p_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_q_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
PEK-S1_s_Smoe_PEK-Unclassified    -VFKEGEMLQ--RC-EHPNIVKYFD-MWKEEGEPG-------------------------
GK065_Glam_GCN2                   -IMNEVRILS--RL-LHPFIVKYYY-SWIETTSDTVQNATEAP-N---------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      ------------------------------------------------------------
HRI_Hsap_HRI                      ------------------------------------------------------------
GCN2_Hsap_GCN2                    ------------------------------------------------------DSGPLA
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      ------------------------------------------------------------
HRI_Mmus_HRI                      ------------------------------------------------------------
GCN2_Mmus_GCN2                    ------------------------------------------------------DCTPQA
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    ------------------------------------------------------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                ------------------------------------------------------------
DDB0216407_Ddis_GCN2              ------------------------------------------------------DDD-DD
DDB0219793e_Ddis_PEK              IKNIIYNNHLLFDGNWGTTSEEASYLNESDNPCNRRVNKAKKKVSPQKKKNVNNNNNNS-
DDB0220652_Ddis_PEK-Unclassified  ------------------------------------------------------DHYGEN
DDB0229432_Ddis_PEK               -------------------------------------------GSLGTG----NNDNDES
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   ------------------------------------------------------------
18670_Tthe_GCN2                   ------------------------------------------------------------
21870_Tthe_GCN2                   ------------------------------------------------------------
6287_Tthe_PEK-Unclassified        ------------------------------------------------------------
GCN2_Spur_GCN2                    ------------------------------------------------------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      ------------------------------------------------------------
HRI_Spur_HRI                      -----------------------------------------------------NGFEGEE
CC1G_02807_Ccin_GCN2              ------------------------------------------------------------
AqueK195_Aque_GCN2                ------------------------------------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                ------------------------------------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 ------------------------------------------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 ------------------------------------------------------------
PEKc_Smoe_GCN2                    ------------------------------------------------------------
PEKa_Smoe_GCN2                    ------------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   ------------------------------------------------------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      -W----------------------------------------------------------
HRI_Hsap_HRI                      ---AIELPSLE-------------------------------------------------
GCN2_Hsap_GCN2                    KDDRA-------------------------------------------------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      -W----------------------------------------------------------
HRI_Mmus_HRI                      ---PIQLPSLE-------------------------------------------------
GCN2_Mmus_GCN2                    QDSPA-------------------------------------------------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    -L----------------------------------------------------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                --SS--------------------------------------------------------
DDB0216407_Ddis_GCN2              DDDEF-------------------------------------------------------
DDB0219793e_Ddis_PEK              KKKAL--DQSG-------------------------------------------------
DDB0220652_Ddis_PEK-Unclassified  DNNLFEN-ID--------------------------------------------------
DDB0229432_Ddis_PEK               DDSFF-EDQDE-------------------------------------------------
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   -L----------------------------------------------------------
18670_Tthe_GCN2                   -EDE--------------------------------------------------------
21870_Tthe_GCN2                   -GSQ--------------------------------------------------------
6287_Tthe_PEK-Unclassified        ---TLELSSSFAKKKKSKDNNNVSPSKKDKKEDKQLAIQSNQANLKQQPANSNNPAGQNQ
GCN2_Spur_GCN2                    -RTT--------------------------------------------------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      -F----------------------------------------------------------
HRI_Spur_HRI                      DDEEEEEEEEE-------------------------------------------------
CC1G_02807_Ccin_GCN2              -SAE--------------------------------------------------------
AqueK195_Aque_GCN2                -GEE--------------------------------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                -GEE--------------------------------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 ------------------------------------------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 ------------------------------------------------------------
PEKc_Smoe_GCN2                    -G----------------------------------------------------------
PEKa_Smoe_GCN2                    -G----------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   -S-S--------------------------------------------------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      ------------------------------------------------------------
HRI_Hsap_HRI                      ------------------------------------------------------------
GCN2_Hsap_GCN2                    ------------------------------------------------------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      ------------------------------------------------------------
HRI_Mmus_HRI                      ------------------------------------------------------------
GCN2_Mmus_GCN2                    ------------------------------------------------------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    ------------------------------------------------------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                ------------------------------------------------------------
DDB0216407_Ddis_GCN2              ------------------------------------------------------------
DDB0219793e_Ddis_PEK              ------------------------------------------------------------
DDB0220652_Ddis_PEK-Unclassified  ------------------------------------------------------------
DDB0229432_Ddis_PEK               ------------------------------------------------------------
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   ------------------------------------------------------------
18670_Tthe_GCN2                   ------------------------------------------------------------
21870_Tthe_GCN2                   ------------------------------------------------------------
6287_Tthe_PEK-Unclassified        QKVVDSNKGGISQVASVQNKNSDATNIHIQAQTNNQKGKQQQQQQVNQGKQTQQIQLNNQ
GCN2_Spur_GCN2                    ------------------------------------------------------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      ------------------------------------------------------------
HRI_Spur_HRI                      ------------------------------------------------------------
CC1G_02807_Ccin_GCN2              ------------------------------------------------------------
AqueK195_Aque_GCN2                ------------------------------------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                ------------------------------------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 ------------------------------------------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 ------------------------------------------------------------
PEKc_Smoe_GCN2                    ------------------------------------------------------------
PEKa_Smoe_GCN2                    ------------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   ------------------------------------------------------------


PKR_Hsap_PKR                      ---------DD-------------------------------------------------
PEK_Hsap_PEK                      -LKDESTDWPL--SS-PSPMDAPSV------KIR----------RMDPFATKEHIEIIA-
HRI_Hsap_HRI                      VLSDQE-E-DREQC----------------------------------------------
GCN2_Hsap_GCN2                    ARGQPA-S-DTDGL----------------------------------------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ---------M--------------------------------------------------
PEK_Mmus_PEK                      -LKDESTDWPL--SS-PSPMDAPSV------KIR----------RMDPFSTKEQIEVIA-
HRI_Mmus_HRI                      VLSEQE-G-DRDQG----------------------------------------------
GCN2_Mmus_GCN2                    TCGKTS-G-DTEEL----------------------------------------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    -LGKIKAEK----LAKLH-------------EIKKAKKHTSEGKRVRSADTASFAESFAM
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                -LGA--------------------------------------------------------
DDB0216407_Ddis_GCN2              ESGSES-E-ESQSE----------------------------------------------
DDB0219793e_Ddis_PEK              --AGDD-N-D--------------------------------------------------
DDB0220652_Ddis_PEK-Unclassified  ----SFP------S----------------------------------------------
DDB0229432_Ddis_PEK               DEDEDE-D-E--------------------------------------------------
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   -QTNNNLYSDD-------------------------------------------------
18670_Tthe_GCN2                   -LREDS-K-EEECS----------------------------------------------
21870_Tthe_GCN2                   -MSDQD-D-DNG------------------------------------------------
6287_Tthe_PEK-Unclassified        DQSDED-N-NEDSN----------------------------------------------
GCN2_Spur_GCN2                    GTGETS-P-DTNGV----------G------RGA----------REVP------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      -VGESSLGG----NDGLTSLDTPAFFNKNSELIR----------NHDQ--------LMQ-
HRI_Spur_HRI                      VEEEEEEG-EEQEG----------------------------------------------
CC1G_02807_Ccin_GCN2              -SS---------------------------------------------------------
AqueK195_Aque_GCN2                -FSDSS-E-DEDTT----------------------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                -FSDSS-E-DEDTT----------------------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 -----AMD----------------------------------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 -----AMD----------------------------------------------------
PEKc_Smoe_GCN2                    ---EES------------------------------------------------------
PEKa_Smoe_GCN2                    ---EES------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   -MISSG---CTTGT----------------------------------------------


PKR_Hsap_PKR                      -------S-----LES----S--D------------------------------------
PEK_Hsap_PEK                      -------P-----SPQ---RS--R------------------------------------
HRI_Hsap_HRI                      --------GVKNDESS--------------------------------------------
GCN2_Hsap_GCN2                    --------D--SVE--------------------------AAAPPPIL------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      -------P-----SPE---RS--R------------------------------------
HRI_Mmus_HRI                      --------GVKDNESS--------------------------------------------
GCN2_Mmus_GCN2                    --------G--SVE--------------------------AAAPPPIL------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    PPVVGNTT-----DAE---NSWST--------S------A-------K------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                -----------VPIPG---KE--KIGKKGKLKT--------------GKSLEDKENKANL
DDB0216407_Ddis_GCN2              --------S--ESE---------------------------SSESEES------------
DDB0219793e_Ddis_PEK              -----------DDISSS----------------------SSS------------------
DDB0220652_Ddis_PEK-Unclassified  --------SSY-----------------------------SSVSAAAS------------
DDB0229432_Ddis_PEK               -----------DDVSNS----------------------NFS------------------
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   -------N-----SPS---VS--E--------A------YQK-----N------------
18670_Tthe_GCN2                   --------SENDSAPS---KA---------------------------------------
21870_Tthe_GCN2                   --------E-LS----------------------------DDRYRY--------------
6287_Tthe_PEK-Unclassified        --------TFYFEDEF--------------------------------------------
GCN2_Spur_GCN2                    --LAVNSLS-LSDN--------------------------I-EEQALK------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      -------Q-----TGG---RS--S---------------M-------G------------
HRI_Spur_HRI                      --------TEKDEEDSFYEKS--K--------NIYSCQENESISKLGS------------
CC1G_02807_Ccin_GCN2              ----------------------------------------------MI------------
AqueK195_Aque_GCN2                --------E-EEEE--------------------------EEEEREEG------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                --------E-EEE---------------------------EEEEREEG------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 -------------EPS---TS------------------F-------G------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 -------------EPS---TS------------------F-------G------------
PEKc_Smoe_GCN2                    ---------------------------------------------EIS------------
PEKa_Smoe_GCN2                    ---------------------------------------------EIS------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   ---------GDD------------------------------------------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      ------------------------------------------------------------
HRI_Hsap_HRI                      --------------------------------S---SSII----FA--------------
GCN2_Hsap_GCN2                    --------------------------------S---SSVE--------------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      ------------------------------------------------------------
HRI_Mmus_HRI                      ------------------------------------SSIV----FA--------------
GCN2_Mmus_GCN2                    --------------------------------S---SSVE--------------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    --------------------------------P---Q-----------------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                GGGDSLMPMNLRGLVKDHSIGVDAKEWSTPFGKPEGPK----------------------
DDB0216407_Ddis_GCN2              --------------------------------S---ESEE--------------------
DDB0219793e_Ddis_PEK              ----------------------------------------S-------------------
DDB0220652_Ddis_PEK-Unclassified  --------------------------------S---SSLVS-------------------
DDB0229432_Ddis_PEK               ----------------------------------------DSIKFKGGFKKSSCSNNSIS
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   --------------------------------K---S-----------------------
18670_Tthe_GCN2                   ------------------------------------------------------------
21870_Tthe_GCN2                   ------------------------------------------------------------
6287_Tthe_PEK-Unclassified        --------------------------------D---NEVV----FI--------------
GCN2_Spur_GCN2                    --------------------------------L---------------------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      --------------------------------P---S-----------------------
HRI_Spur_HRI                      --------------------------------T---SPIITE------------------
CC1G_02807_Ccin_GCN2              --------------------------------T---SSEV--------------------
AqueK195_Aque_GCN2                --------------------------------L---SFIE--------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                --------------------------------L---SFIE--------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 --------------------------------P---S-----------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 --------------------------------Q---S-----------------------
PEKc_Smoe_GCN2                    --------------------------------S---SW----------------------
PEKa_Smoe_GCN2                    --------------------------------S---SW----------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   ------------------------------------------------------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      ---------------------------SFS------------------------------
HRI_Hsap_HRI                      ----EPT-----------------------------------------------------
GCN2_Hsap_GCN2                    ----------------------------W-------------------------------
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      ---------------------------SFS------------------------------
HRI_Mmus_HRI                      ----ELT-----------------------------------------------------
GCN2_Mmus_GCN2                    ----------------------------W-------------------------------
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    --------------------------------E---------------------------
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                ------------------------------------------------------------
DDB0216407_Ddis_GCN2              ----------------------------S-------------------------------
DDB0219793e_Ddis_PEK              ------------------------------------------------------------
DDB0220652_Ddis_PEK-Unclassified  ----NSSNSY--------------------------------------------------
DDB0229432_Ddis_PEK               SNLKKKRNDKKYPFKRNLS-------ISFS------------------------------
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   ----------------DYN-------RSYA------------------------------
18670_Tthe_GCN2                   ------------------------------------------------------------
21870_Tthe_GCN2                   ------------------------------------------------------------
6287_Tthe_PEK-Unclassified        ----E-------------------------------------------------------
GCN2_Spur_GCN2                    -----------------------------S------------------------------
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      --------------YVPFSKTRESPILKFDLSDDSNVSSEGRVDQKGDNKRAGVESDILF
HRI_Spur_HRI                      --LVETRSER---HSQQTS-------MTVS------------------------------
CC1G_02807_Ccin_GCN2              ----------------------------T-------------------------------
AqueK195_Aque_GCN2                ----------------------------FK------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                ----------------------------FK------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 --------------------------------NS--------------------------
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 --------------------------------NL--------------------------
PEKc_Smoe_GCN2                    ------------------------------------------------------------
PEKa_Smoe_GCN2                    ------------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEKb_Smoe_PEK-Unclassified        ------------------------------------------------------------
PEK-S1_u_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_a_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_b_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_c_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_d_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_e_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_f_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_g_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_h_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_i_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_j_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_k_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_l_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_m_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_n_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_o_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_p_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_q_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_s_Smoe_PEK-Unclassified    ------------------------------------------------------------
GK065_Glam_GCN2                   ------------------------------------------------------------


PKR_Hsap_PKR                      ------------------------------------------------------------
PEK_Hsap_PEK                      ---VGISC--------D----------Q---------TS-----SSESQF--SPLEFS-G
HRI_Hsap_HRI                      -------PEKEKR-----------------------------------------F-----
GCN2_Hsap_GCN2                    ----S--------TSGERS-------------------------------ASARFPAT-G
GCN2~b_Hsap_GCN2                  ------------------------------------------------------------
Gcn2_Dmel_GCN2                    ------------------------------------------------------------
Gcn2~b_Dmel_GCN2                  ------------------------------------------------------------
PEK_Dmel_PEK                      ------------------------------------------------------------
PKR_Mmus_PKR                      ------------------------------------------------------------
PEK_Mmus_PEK                      ---VGISC--------G----------Q---------TS-----SSESQF--SPLEFS-G
HRI_Mmus_HRI                      -------PEKEKP-----------------------------------------F-----
GCN2_Mmus_GCN2                    ----S--------TSAERS-------------------------------TSTRFPVT-G
GCN2~b_Mmus_GCN2                  ------------------------------------------------------------
pek-1_Cele_PEK                    --------------------------------------V-----GAKRTTSESKLGLHGG
GCN2_Scer_GCN2                    ------------------------------------------------------------
Y38E10A.8_Cele_PEK                ------------------------------------------------------------
Y81G3A.3_Cele_GCN2                --------------------------------------CASRMRQSKRSTPSGGLKHLS-
DDB0216407_Ddis_GCN2              ----SES------SESEES-------------------------------EESEYS----
DDB0219793e_Ddis_PEK              ---------SS--SSSDDSLYKLQFPHDEDFKQFNKQTS-----IRESMINSSRFKKS--
DDB0220652_Ddis_PEK-Unclassified  ------------------------------------------------------------
DDB0229432_Ddis_PEK               ---LNDSVTNT--NSQEYSI-SEYF---------------------------EKFNLT-N
IfkB_Ddis_GCN2                    ------------------------------------------------------------
11434_Tthe_GCN2                   ---LSKQT--------N----------Q---------TQ-------------SYV-L---
18670_Tthe_GCN2                   ------------------------------------------------------------
21870_Tthe_GCN2                   ------------------------------------------------------------
6287_Tthe_PEK-Unclassified        --------ENSKS--------------------IK-------------------Q-----
GCN2_Spur_GCN2                    ---IRNS--------LEWS-------------------------------SSGNIGLI--
GCN2~b_Spur_GCN2                  ------------------------------------------------------------
PEK_Spur_PEK                      PGAVCEFE--------ESGSFSIVFQGT---------EE-----ENSQNM--SVISDT-G
HRI_Spur_HRI                      ---M--NPAETDPF-------------------------------------DSNFTVS-F
CC1G_02807_Ccin_GCN2              -------------SIPDDD-------------------------------SERHLPIN-G
AqueK195_Aque_GCN2                ---LDES--------TT-------------------------------------------
AqueK195~b_Aque_GCN2              ------------------------------------------------------------
AqueK194_Aque_GCN2                ---LDES--------TR-------------------------------------------
AqueK194~b_Aque_GCN2              ------------------------------------------------------------
AqueK193_Aque_GCN2                ------------------------------------------------------------
AqueK196_Aque_PEK                 ---------------------------L---------SV-----QSVRTL--SPIGAN-H
AqueK197_Aque_PEK                 ------------------------------------------------------------
AqueK198_Aque_PEK                 ------------------------------------------------------------
AqueK199_Aque_PEK                 ---------------------------S---------SV-----QSARTL--SPVGAS-I
PEKc_Smoe_GCN2                    ------------------------------------------------------------
PEKa_Smoe_GCN2                    ------------------------------------------------------------
PEK_d_Smoe_PEK                    ------------------------------------------------------------
PEK-S1_r_Smoe_PEK-Unclassified    ------------------------------------------------------------
PEK-S1_t_Smoe_PEK-Unclassified    ---------------------------------