Protein (view, download) , Domain (view, download)
SCYL3_Hsap       MGSE--NSAL--------------------------------------------------
SCYL2_Hsap       MESM--LNKLKSTVTKV--TA------------------------------DVTSAVMG-
SCYL1_Hsap       MWF---F--------------------------------------------------AR-
SCY1_Scer        MMFW--SSK-T-G-----------------------------------------------
CG1973_Dmel      MWSF--F--------------------------------------------------SR-
CG1951_Dmel      MDMI---NKFYSSAVQT--VS------------------------------TLSGVLPG-
CG14163_Dmel     MPAGTMFAKFKSTNVAA--ST------------------------------ATQAVADG-
SCYL1_Mmus       MWF---F--------------------------------------------------AR-
SCYL2_Mmus       MESM--LNKLKSTVTKV--TA------------------------------DVTSAVMG-
SCYL3_Mmus       MGSE--NSAL--------------------------------------------------
W07G4.3_Cele     MASV--LS----------------------------------------------SFFQR-
ZC581.9_Cele     MASS--SN-FMAPPPKMNKTSSMNSLRKTLGLKKPNNGELSMVPSRPIVSPTLSSPLQGS
Scy1_Ddis        MYIFKL---MGQ-------------------------------------------NLTA-
Scy2_Ddis        MDTTKS---FNFK-EKV--RG------------------------------FLGSAASV-
3125_Tthe        MGN----------------------------------------------------QL---
SCYL2_Spur       MEML---NKLKSTVG----------------------------------------GLIG-
SCYL3_Spur       MGVE--SSAL--------------------------------------------------
SCYL1_Spur       MWSF--L--------------------------------------------------SR-
CG1344_Dmel      MLSV--FEG---------------------------------------------------
CC1G_05159_Ccin  MAHV--LAA-AS------------------------------------------SFFGR-
CC1G_02059_Ccin  MDYL--RTL-GSAA--------V------------------------------STLVQK-
AqueK202_Aque    MGQQ--QG--------------------------------------------------K-
AqueK203_Aque    WMYS--YN--------------------------------------------------D-
AqueK204_Aque    MLKS--AA----------------------------------------------------
AqueK205_Aque    MSLL---GKLKTA-------------------------------------------IKG-
SCY1_Smoe        MALN--MKSLTQALAKT--AAVIE----------KH------------VQ-STVQEVTG-
GK067_Glam       MQQQ--APAYFK--SRI--EP-------------------------------RATPNAP-


SCYL3_Hsap       -----K--SYTLREPPF-TL----------------------------PSG--LAVYPAV
SCYL2_Hsap       --NPV-TREFDVGRHI-ASG----------------------------GNGLAWKIFNGT
SCYL1_Hsap       --DPVRDFPFELIPEP-PEG----------------------------GLPGPWALHRGR
SCY1_Scer        ----I-TSKYSFSSSP-TF------------------------------TAEPWSIYTGR
CG1973_Dmel      --DSSKDFPYDIGEPV-GGF----------------------------DQYSIWTLHKAK
CG1951_Dmel      --NNV-TREYEVLEQV-CTA----------------------------GVGLMWKVYNGH
CG14163_Dmel     --NPI-TQYFEIGKPV-ACA----------------------------GPELVWRIHDAY
SCYL1_Mmus       --DPVRDFPFELSPEP-PEG----------------------------GPPGPWILHRGR
SCYL2_Mmus       --NPV-TREFDVGRHI-ASG----------------------------GNGLAWKIFNGT
SCYL3_Mmus       -----K--SYTLRESPF-TL----------------------------PSG--LAVYPAI
W07G4.3_Cele     --DPKSQFPYDIPGAE-EHF----------------------------F-DR-VSIGNSF
ZC581.9_Cele     GAAPL-EKDYHSLEYR--------------------------------LTHGHWRIFNSK
Scy1_Ddis        ----SQSFPYNIGPI-VTGY----------------------------VGKSIWTLHSGT
Scy2_Ddis        -ISPIKD--HDLKE----VV----------------------------GQDKFWKIYQST
3125_Tthe        ----FKN--YDVEKEPQCVG----------------------------GQNGIWKIYNAV
SCYL2_Spur       --NPV-MREYEIIRHV-GSG----------------------------GPGCLWKIYHAV
SCYL3_Spur       -----S--GCTLEDPLP-ES----------------------------ASAQDWKIHPAK
SCYL1_Spur       --DPTRAFPFEIGEKV-EGL----------------------------EDKSIWTLHQGK
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  --TNI-SQSYNIGNPS-QTSRPSTPGTTSGGSSGGGGANIAPLPFTPTFYIGLWKVQPAT
CC1G_02059_Ccin  --SGL-NLPFTLGAKV-AT------------------------------FDTIYTLYDGT
AqueK202_Aque    --D---QLPVDIGEEI-SSL----------------------------SNKTIWNVHFGN
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    --NPV-LREYELGKQV-ASA----------------------------GPGLLWKVFNGE
SCY1_Smoe        --PKP-LQDYELVEQI-GSG----------------------------GPALAWKLYSGR
GK067_Glam       --KIK-LKEWELEKQL-GFG----------------------------GTFGIWHMYSGR


SCYL3_Hsap       L-Q-----DGKFASVFVYKRENED------------------------------------
SCYL2_Hsap       KKS-----TKQEVAVFVFDKKLI---DKYQ------------------------------
SCYL1_Hsap       KKAT-----GSPVSIFVYDVKPGA------------------------------------
SCY1_Scer        PKSSS-SSSPSKVSIFMFDKKQFEN-YLL--HYGIIKSKSGS------------------
CG1973_Dmel      RKTT-----LEEVSVFVYDIRSGS------------------------------------
CG1951_Dmel      KKS-----TKQEVSVFVFEKKSL---ERWS------------------------------
CG14163_Dmel     RKS-----DNKECSVFIFEKKIA---EKLH------------------------------
SCYL1_Mmus       KKAT-----GSAVSIFVYDVKPGA------------------------------------
SCYL2_Mmus       KKS-----TKQEVAVFVFDKKLI---DKYQ------------------------------
SCYL3_Mmus       L-Q-----DGKCASVFVYKRENED------------------------------------
W07G4.3_Cele     KKAE-----PGELATIFWDNR---------------------------------------
ZC581.9_Cele     SVF-----GNKDASVLVFDKKSNVK---APPKL---------------------------
Scy1_Ddis        KK-----EDGSAVSIFSFDIKKNP--SK--------------------------------
Scy2_Ddis        KK-----TTNTECSLFVFEKKLY---EKVS------------------------------
3125_Tthe        KQD----STKRKVSIWSFDKKNIT--DKAA------------------------------
SCYL2_Spur       KRS-----TKQEAGVFVFEKKLL---ERFA------------------------------
SCYL3_Spur       R-P-----DGSRVSVFVHKYDEEKSRQDIY-QH-------AANGFIAHNVKVSAQSQCKM
SCYL1_Spur       RKAN-----GEPVSVFMVDLKSHS------------------------------------
CG1344_Dmel      --------------------KVFVK---AH------------------------------
CC1G_05159_Ccin  HKVT-----GKRVSVWSFDKRGPEM-ERL-------------------------------
CC1G_02059_Ccin  KRDD-----GSPVSIFEYELSGRN------------------------------------
AqueK202_Aque    RKPA-----NDPVLVFIFNFANKS------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    KKS-----TKQAVSVFIFYKTAPEL-EKVP------------------------------
SCY1_Smoe        PRNKAEHAHNPEVCVWVLDKKLL---SETRQRI-------GI------------------
GK067_Glam       NKK-----SNAFGTVFVIEKKLV---EKFV--F-------GK------------------


SCYL3_Hsap       ------------------------------KVNKAAKHLKTLRHPCLLRFLSCTVE-ADG
SCYL2_Hsap       ------------------KF-EKDQI--IDSLKRGVQQLTRLRHPRLLTVQHPLEESRDC
SCYL1_Hsap       -----------------------EEQ--TQVAKAAFKRFKTLRHPNILAYIDGLET-EKC
SCY1_Scer        ----------------RDKV-LIQEA--YEILRNQANNLAKLKHPNILTLIEPLEEHSKN
CG1973_Dmel      -----------------------DTK--CELAKAALKRLKTLRHPSILQYLDSLET-DKM
CG1951_Dmel      ------------------KD-DRETM--LETLRRGVQQLTKIRHPHVLTVQHPLEESRDS
CG14163_Dmel     ------------------KPRRKETI--TELLKSSVKTLERFRHPRILQIYHTVEESADT
SCYL1_Mmus       -----------------------EEQ--TQVAKAAFKRLKTLRHPNILAYIDGLET-EKC
SCYL2_Mmus       ------------------KF-EKDQI--IDSLKRGVQQLTRLRHPRLLTVQHPLEESRDC
SCYL3_Mmus       ------------------------------KVNKAAKHLKTLRHPCLLRFLSCTVE-ADG
W07G4.3_Cele     ----------------------------SSTLKQQAQKLKTMRHPNIITYLDSIEL-EGT
ZC581.9_Cele     -----------------GKS-KTYSM--FDLIKYETQQLMGLIHPRILHMEHSLEETKDY
Scy1_Ddis        ----------------------------LEVAKNGFKRAKTTRHPNVLKYLDGLET-ETN
Scy2_Ddis        ------------------KS-NLENV--ITFLKKEATTLQRLRHPSILQVVSVMEETKTH
3125_Tthe        ------------------KA-AKEEI--AAFLKKEATSMMKIRHPNIVNLVEPVIEDKYS
SCYL2_Spur       ------------------KR-DRDPL--LEILRKGSTQLTRLRHPCVLTVQHPLEETRES
SCYL3_Spur       HQENHPGIRFLHRHCADQKY-GTSAFLQTILVFEDALQLKVLRHPTILKFFASCNN-VDS
SCYL1_Spur       -----------------------ESI--VQLAKSAHKRLKTLRHPNFLLYVDGLET-ENV
CG1344_Dmel      ------------------V---WSNG--VGPIERAIKNLMVYRHPYILKYIATWEK-SGR
CC1G_05159_Ccin  -----------------GVA-GKDRV--LEVLKNEASALSRLRHPSILEMVEPLEETRIE
CC1G_02059_Ccin  -------------------------T--RALAQNALRKLRTTRHPDVLKFMDVVET-DST
AqueK202_Aque    -----------------------DDE--IRQARSAHLRLKTLRHPNILRYIDGVEL-LDS
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    -----------------------------------------------------LE-----
AqueK205_Aque    ------------------KK-EREAL--FELLKKGPTHLAKFRHPKILTVDHPVEESSDC
SCY1_Smoe        -----------------TKA-AEDAF--LEVVRADAGQMLKLRHPGVLRVVQALDESKTA
GK067_Glam       -----------------ADN-LSKQF--FSFINKDAAV-PGKNAKEILIILEQLQEENNC


SCYL3_Hsap       IHLVTERVQP-LEVALE-------------------------------------------
SCYL2_Hsap       LAFCTEPVFASLANVLGNWENLPS------------------------------------
SCYL1_Hsap       LHVVTEAVTP-LGIYLKARVE---------------------------------------
SCY1_Scer        FMFVTEFVTSSLETVFRETDDEEQ------------------------------------
CG1973_Dmel      LYVATEAVDP-LGTYFSKLGS---------------------------------------
CG1951_Dmel      LAFATEPVFASLANVVGDNVR---------------------------------------
CG14163_Dmel     LAFASEPIFASLSNVLAFHESKTYEATNVA-------------PAAGGAAASQAQAAANT
SCYL1_Mmus       LHIVTEAVTP-LGTYLKARAE---------------------------------------
SCYL2_Mmus       LAFCTEPVFASLANVLGNWENLPS------------------------------------
SCYL3_Mmus       IHLVTERVQP-LEVALE-------------------------------------------
W07G4.3_Cele     FYLVTEKCKP-LELYLKEAGL---------------------------------------
ZC581.9_Cele     ISFATEQIFGNLENVVT-------------------------------------------
Scy1_Ddis        IYIVTEPIQL-LDELLED------------------------------------------
Scy2_Ddis        IHFATEPILATLEDLLGYYRQRKKST---VDQ--------------------------SS
3125_Tthe        MAFVTERVDDNLYNLMKKGD----------------------------------------
SCYL2_Spur       LAFATEPVFASLANILGCHDNMPS------------------------------------
SCYL3_Spur       TYLVTEQVKP-LELVIE-------------------------------------------
SCYL1_Spur       IYVVTEEVTP-LGTFLKTNA----------------------------------------
CG1344_Dmel      KYLATERVRP-LDEVLA-------------------------------------------
CC1G_05159_Ccin  LVFATEPVLSSLELSIPGSGRHA-------------------------------------
CC1G_02059_Ccin  IHIMTERVRP-LQSALSSWS----------------------------------------
AqueK202_Aque    IYMMTEEATP-LQEVLESAT----------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    LAFATEPIVASLANVLGYYANLPS------------------------------------
SCY1_Smoe        MAMVTEPIFASVANVLGNLENVS-------------------------------------
GK067_Glam       LYYVTEPLVGTLSSLYKLFGHTCLN---VIKRKADHEMLANANPR--------------I


SCYL3_Hsap       -----------------------TLSSAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSV
SCYL2_Hsap       --PISPD------------IKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENI
SCYL1_Hsap       ---------------------AGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAV
SCY1_Scer        -----NF------------LQGHVKDNIVVQRGILQLVNALDFVHNRASFVHLNIQPRAI
CG1973_Dmel      ---------------------DNVQKGLYLAWGIFQITRALSFLNNDGNLRHNNVSAWSV
CG1951_Dmel      --------------------SEKKLYDVEIRHGLLQLFDGLQFLHQDAKIVHRNISAETI
CG14163_Dmel     LPQRPAH------------AKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSI
SCYL1_Mmus       ---------------------AGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAV
SCYL2_Mmus       --SISPD------------IKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNVTPENV
SCYL3_Mmus       -----------------------TLSPAEVCAGIYDILLALIFLHDRGHLTHNNVCLSSV
W07G4.3_Cele     ---------------------TESQKEFVVSWGMFQLLNALKFMHE-AKLSHENLR-KGV
ZC581.9_Cele     ---------------------DESLDRLEIKLGVLQIIDGMSYLHNSAKMLHGNLTPDAI
Scy1_Ddis        ----------------------IRNFENAISWGLYQ--EGLSFLNNKCNLTHGNIQSSSI
Scy2_Ddis        QSEEGYK------------KKDFTFEELELKAGIFQILDGLLFLNQTAKLLHRNISPESI
3125_Tthe        -------------------YKAICQSELELKLQVENILKVLQFLHNDVKTAHLGIAPENI
SCYL2_Spur       --PIPPY------------IGEHKLFEVEIKYGLLQLTDALKFLHNDVHMVHGNITPASI
SCYL3_Spur       -----------------------MLSPEEICAGMYNIIEALSFLHDRGGVSHNNVCMSSI
SCYL1_Spur       ------------------------PKESTISWGLYQVVKGLSFLHNDCKLKHNNVNLSCV
CG1344_Dmel      -----------------------QQTDIEVCLGLRTILCALIFLVEKALARHLNINTQSI
CC1G_05159_Ccin  --------------------SLVELDEIEIQKGILQLAKGLSFLHSQAQLIHSNICPESI
CC1G_02059_Ccin  -----------------------TKTEQERQDWLLWGLHPLTFLNDPCSSTHGAFNTNAI
AqueK202_Aque    -----------------------PPSEHLVSWGIHQIIKSISFLSNDCSLIHNNVAIHSV
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    -------------------------------------EKSISFLSNDCSLIHNNVAIHSV
AqueK205_Aque    --PLPPDIKHKPMITGTSTLHEYQVHTLEVHYGLLQLAEGLNFLHNNVKMRHGNLCIDNI
SCY1_Smoe        --KTPKE------------LRGLELGLLEIKHGLLQLTETLSFLHNNAQLVHRAISPESV
GK067_Glam       YSANPFT------------NLLQYVQPDSIAYGYMTLLRSLSILQNDGY-VFGNLTPANI


SCYL3_Hsap       FVS-EDGHWKLGGMETVCKVSQATPEFLRSI-QS--------------------------
SCYL2_Hsap       ILN-KSGAWKIMGFDFCVSSTNPSEQ---EPKFPCKEW----------------------
SCYL1_Hsap       FVD-RAGEWKLGGLDYMYSAQGN-------------------------------------
SCY1_Scer        FIN-ENSDWKISGLGYLVKIPPGTNT----SEYFLPQY----------------------
CG1973_Dmel      FVN-ASGEWKLGSLEYVSAADGN-------------------------------------
CG1951_Dmel      VIN-KNRSWKLFGFDFCIANQPATDG---TPHWPFREY----------------------
CG14163_Dmel     LIT-KRGIWKLAGMEYVERMNEND-L---NSSIPCPPW----------------------
SCYL1_Mmus       FVD-RAGEWKLGGLDYMYSAQGN-------------------------------------
SCYL2_Mmus       ILN-KSGAWKIMGFDFCVSSSNPSEQ---EPKFPCKEW----------------------
SCYL3_Mmus       FVS-EDGHWKLGGMETVCQVPQATPEFLRNI-QS--------------------------
W07G4.3_Cele     FVT-AGGDWKIGGLHLVTGFTSP-------------------------------------
ZC581.9_Cele     YVT-ATKTWKIGGFSFAVNAKEPNCY-------PCYPW----------------------
Scy1_Ddis        FVN-KGGDWQIGGLDFVSDVKDINNSILRNH-----------------------------
Scy2_Ddis        FIT-KDLKWKLGGLGFTCSIETKEPPISNLSLQDLREY----------------------
3125_Tthe        FIV--NGQWKIAGFTFSTPIQNQTSTDVQNADFTKRP-----------------------
SCYL2_Spur       ILN-SNGAWKLAGFDFVIPSSSPPDQ---PAIFPLREL----------------------
SCYL3_Spur       YVSCTDGGWRLGGMEHLCKFEDATLQFLNQS-RP--------------------------
SCYL1_Spur       FVT-RAGEWKLGAVDYITPSEGEGST---NPDKGLRSLEKYNPPEMTDARTRKRPCPWAA
CG1344_Dmel      YVT-ESGSWRLAGFEYVWRATDVNKQLLDLA-HS--------------------------
CC1G_05159_Ccin  IIN-SSGDWKISGLGVTIPLLTNGNP----TRWEFPTF----------------------
CC1G_02059_Ccin  FIS-PSGEWKLGGFELLSNPKDDAA-----VL--YTS-----------------------
AqueK202_Aque    FVD-AAGEWKLSGVEWMYSYNDT-------------------------------------
AqueK203_Aque    ----------------------T-------------------------------------
AqueK204_Aque    FAD-AAGEWKLSGVEWM-------------------------------------------
AqueK205_Aque    TIS-TNGDWKLAGFNFASSIESETP------GYSFKE-----------------------
SCY1_Smoe        FIT-STGSWKFGGFGFAATVEQTAAEAGAGASFLYPEY----------------------
GK067_Glam       AIT-PRGEWRLVGFSCCLPGGIN-F-----------EF----------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ------------------------------------------------------------
SCYL1_Hsap       ------------------------------------------------------------
SCY1_Scer        ------------------------------------------------------------
CG1973_Dmel      ------------------------------------------------------------
CG1951_Dmel      ------------------------------------------------------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       ------------------------------------------------------------
SCYL2_Mmus       ------------------------------------------------------------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ------------------------------------------------------------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ------------------------------------------------------------
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       DMWGLGCLIWEVFNGTLPRTSSLKALGKIPKHLVPNYCELVGANPISRPNPAKFIESCQN
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ------------------------------------------------------------
CC1G_02059_Ccin  ------------------------------------------------------------
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ------------------------------------------------------------
GK067_Glam       ------------------------------------------------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ------------------------------------------------------------
SCYL1_Hsap       ------------------------------------------------------------
SCY1_Scer        ------------------------------------------------------------
CG1973_Dmel      ------------------------------------------------------------
CG1951_Dmel      ------------------------------------------------------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       ------------------------------------------------------------
SCYL2_Mmus       ------------------------------------------------------------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ------------------------------------------------------------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ------------------------------------------------------------
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       SGGFMKNSFVDTNLFLEEIQIKDQTEKTKFLSGLSAAIDDFPEEFCRHRILPLLLQAFEF
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ------------------------------------------------------------
CC1G_02059_Ccin  ------------------------------------------------------------
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ------------------------------------------------------------
GK067_Glam       ------------------------------------------------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ------------------------------------------------------------
SCYL1_Hsap       ------------------------------------------------------------
SCY1_Scer        ------------------------------------------------------------
CG1973_Dmel      ------------------------------------------------------------
CG1951_Dmel      ------------------------------------------------------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       ------------------------------------------------------------
SCYL2_Mmus       ------------------------------------------------------------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ------------------------------------------------------------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ------------------------------------------------------------
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       GNAGSAILTPLLKLGKLLDDDEYQKRVVPIVVKLFSSTDRNTRVKLLQQTRDDELVCCKE
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ------------------------------------------------------------
CC1G_02059_Ccin  ------------------------------------------------------------
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ------------------------------------------------------------
GK067_Glam       ------------------------------------------------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ------------------------------------------------------------
SCYL1_Hsap       ------------------------------------------------------------
SCY1_Scer        ------------------------------------------------------------
CG1973_Dmel      ------------------------------------------------------------
CG1951_Dmel      ------------------------------------------------------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       ------------------------------------------------------------
SCYL2_Mmus       ------------------------------------------------------------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ------------------------------------------------------------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ------------------------------------------------------------
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       KLCATVNSNSCTYPTRAFPFEIGEKVEGLEDKSIWTLHQGKRKANGEPVSVFMVDLKSHS
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ------------------------------------------------------------
CC1G_02059_Ccin  ------------------------------------------------------------
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ------------------------------------------------------------
GK067_Glam       ------------------------------------------------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ------------------------------------------------------------
SCYL1_Hsap       ------------------------------------------------------------
SCY1_Scer        ------------------------------------------------------------
CG1973_Dmel      ------------------------------------------------------------
CG1951_Dmel      ------------------------------------------------------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       ------------------------------------------------------------
SCYL2_Mmus       ------------------------------------------------------------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ------------------------------------------------------------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ------------------------------------------------------------
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       ESIVQLAKSAHKRLKTLRHPNFLLYVDGLETENVIYVVTEEVTPLGTFLKTNAPKESTIS
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ------------------------------------------------------------
CC1G_02059_Ccin  ------------------------------------------------------------
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    ------------------------------------------------------------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ------------------------------------------------------------
GK067_Glam       ------------------------------------------------------------


SCYL3_Hsap       ------------------------------------------------------------
SCYL2_Hsap       ---------------------------------------------------D--------
SCYL1_Hsap       ---------------------------------------------------G--------
SCY1_Scer        ---------------------------------------------------D--------
CG1973_Dmel      ---------------------------------------------------P--------
CG1951_Dmel      ---------------------------------------------------T--------
CG14163_Dmel     ---------------------------------------------------S--------
SCYL1_Mmus       ---------------------------------------------------G--------
SCYL2_Mmus       ---------------------------------------------------D--------
SCYL3_Mmus       ------------------------------------------------------------
W07G4.3_Cele     ------------------------------------------------------------
ZC581.9_Cele     ---------------------------------------------------T--------
Scy1_Ddis        ------------------------------------------------------------
Scy2_Ddis        ---------------------------------------------------QYISGGGGG
3125_Tthe        ------------------------------------------------------------
SCYL2_Spur       ---------------------------------------------------M--------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       WGLYQVVKGLSFLHNDCKLKHNNVNLSCVFVTRAGEWKLGAVDYITPSEGEG--------
CG1344_Dmel      ------------------------------------------------------------
CC1G_05159_Ccin  ---------------------------------------------------D--------
CC1G_02059_Ccin  ---------------------------------------------------A--------
AqueK202_Aque    ---------------------------------------------------N--------
AqueK203_Aque    ---------------------------------------------------N--------
AqueK204_Aque    ------------------------------------------------------------
AqueK205_Aque    ------------------------------------------------------------
SCY1_Smoe        ---------------------------------------------------D--------
GK067_Glam       ---------------------------------------------------S--------


SCYL3_Hsap       --IRD-PASI--P-PEEMSPEF-----TTLPECHGHARDAFSFGTLVESLLTILNEQ-VS
SCYL2_Hsap       --PN-LPSLCL-PNPEYLAPEYILSV------SCETASDMYSLGTVMYAVFNKGKPIFEV
SCYL1_Hsap       --GG-PPRKGIPELEQYDPPELADSS--GRVVREKWSADMWRLGCLIWEVFNGPLPRAAA
SCY1_Scer        --PR-VPPFMH-LQLNYTAPEIV------FENTLTFKNDYFSLGLLIYFLYTGK-DLFRS
CG1973_Dmel      ---M-PPAKIPVTLEVYDSPEKNDPS--KLKAATKCSVDMWGLGCLVWEAFNGVLKQRSN
CG1951_Dmel      --TS-LHVLAQ-PSLEYTAPELALNS------VNTPDSDLFSLGVLIFTIYAG-KPLKMF
CG14163_Dmel     --NR-VSKMAQ-PNLDFMAPETQSTS------KCSLLSDMFSLGMVICAVFNNGRPLIQA
SCYL1_Mmus       --GG-PPSKGIPELEQYDPPELADSS--SRAVREKWSADMWRLGCLIWEVFNGSLPRAAA
SCYL2_Mmus       --PN-LPSLCL-PNPEYLAPEYILSV------SCETASDMYSLGAVMYAVFNQGRPIFEV
SCYL3_Mmus       --VRD-PASI--P-PEEMSPEF-----SGLPESHGHARDAYAFGALVDSLLPIFNEQ-VS
W07G4.3_Cele     ------------------------------------QTDLNQLAIVLWEVFNGFNDAITR
ZC581.9_Cele     --KK-LPPCLQ-PDLDFLAPENLAPG----QTTVTSAADVFSLGVLICWIYAGGKRLIDA
Scy1_Ddis        -------NDLI-P-NKYKSPEIMKSQWQQIQQSPSYSIDSWMLGCLMYECYNGTMTKAED
Scy2_Ddis        ESSNN-SNYIL-PQLDYLAPEFIS------QRKFETNSDLFSIGRLIFELSINLEQKALD
3125_Tthe        --FDH-FAQFY-PNLSFSAPEVAE-----IPPKCTFASDIFSLSLLILLMYQIKYMQTTN
SCYL2_Spur       --ND-VSAVLQ-PNLNYLAPEYLLTQ------SCDMSSDLFSLGMLMYSVINTGKLFHDC
SCYL3_Spur       --LRN-SQAI--P-PEEKQDGV----KTSIGPSMGHARDAYGFGALALTLLEYLGDL---
SCYL1_Spur       --ST-NPDKGLRSLEKYNPPEMTDVR--ARKRPCPWAADMWGLGCLIWEVFNGTLPRTSS
CG1344_Dmel      --FID--------L-----------------TIHGENFEQFFFSILCEKVLSRKGT-DSC
CC1G_05159_Ccin  --GR-VPAYIQ-RSFDYMAPEYA------LDEQLLTSSDMYSLGCVVYAVHSKGNPPFKN
CC1G_02059_Ccin  --SL-LP-----GSMNTAPPEVKKSGWSTLKQHDVAAADAYALGLLLHTLFNPSHPPPAT
AqueK202_Aque    ---I--PLKTFQSLNKYDPPENMKQA--K-RKTEKWSRDMWGLGCLLWEVFNGPIHQSSN
AqueK203_Aque    ---V--PLKTFQYLNKYDPPENMKQA--K-RKTEKWSRDMWGLGCLLWEVFNGPIHQSSN
AqueK204_Aque    ------------------------------------SRDMWGLGCLLLEVFNGPIHQSSN
AqueK205_Aque    ---T-KAFPLH-PTLNYLAPEVVLSN------TVNEKCDLYSFGMLIFAIYNSGKPLFDC
SCY1_Smoe        --VDEVVMPLQ-PPLNYTAPELTRSN-----GNPGSCSDIFSLGCLIYHLLSR-EPLVLC
GK067_Glam       --SD-SGALTR-PCAHFMSPSMLQNK------KASKVSDAFQLASCIYTIFGG-RPCKYS
                                                       :   :.

SCYL3_Hsap       AD----------VL--------------------------------------SSFQQ---
SCYL2_Hsap       NKQD--------IYKSFSRQLDQLSRL--------------------GSSSLTNIPEEVR
SCYL1_Hsap       ------------------------------------------------LRNPGKIPKTLV
SCY1_Scer        EN----------STSEYKLEYNKFESKI--------S-------TMSWDNIFSKVPQKLR
CG1973_Dmel      ------------------------------------------------LKDIEHIPKSLQ
CG1951_Dmel      GS----------DYSSFRRYANDLNQR--------------------KYPPMNAVPSELT
CG14163_Dmel     GN----------STSNYAKQMETLDDL--------------------VHKLMPRLPIALQ
SCYL1_Mmus       ------------------------------------------------LRNPGKIPKSLV
SCYL2_Mmus       NKQD--------IYKSFSRQLDQLSRL--------------------GSSSLTSIPEEVR
SCYL3_Mmus       AD----------VL--------------------------------------SSFLQ---
W07G4.3_Cele     ------------------------------------------------PQAPGKIPQRIH
ZC581.9_Cele     KS----------NLETYHIVVGQLDAA--------------------LQCISNELGPNLK
Scy1_Ddis        I------------------------------------------------KNLDQIPKQLH
Scy2_Ddis        S-HLISQLPKLGVISYYNTMIEQVRR-----------------------QSTMNTQRSDS
3125_Tthe        V-TPMLS---SKTVGEYSSQLGQIQN---------------------HFKSQNYIQRDMN
SCYL2_Spur       NE----------NLSTFKQKSEQLRSL--------------------SISLLSSLPDGLK
SCYL3_Spur       GS----------IS--------------------------------------SSFSA---
SCYL1_Spur       ------------------------------------------------LKALGKIPKHLV
CG1344_Dmel      IT-----------------------------------------------DSTPHV-HEFR
CC1G_05159_Ccin  HG----------SLSNLREN-------A-----------------GKPLPGMERWEQDLQ
CC1G_02059_Ccin  AQ----------PP----H--------P-----------------PPPASSRGSIPLPIF
AqueK202_Aque    ------------------------------------------------LRDTSKFPKSLS
AqueK203_Aque    ------------------------------------------------LRDTSKFPKSLS
AqueK204_Aque    ------------------------------------------------LRDTSKFPKSLS
AqueK205_Aque    KD----------NLRTYKQNIEMTSRI--------------------SESMLGDTPFPLR
SCY1_Smoe        KN----------NLRAYKAKVQYLA-----------------------SASFSKIPPELV
GK067_Glam       SS----------SPCMQHMSTEELCEESAKMFGASLPTTTNVISPAAAAQNAATVPKWYS


SCYL3_Hsap       ----------------------------------T-LHSTLLNP----I-----------
SCYL2_Hsap       ----------------------------------E-HVKLLLNV----T-----------
SCYL1_Hsap       ----------------------------------P-HYCELVGA----N-----------
SCY1_Scer        ----------------------------------H-CIPKLINR----D-----------
CG1973_Dmel      ----------------------------------S-LYCELVGA----S-----------
CG1951_Dmel      ----------------------------------E-SLKALLHP----S-----------
CG14163_Dmel     ----------------------------------E-ATSRMASR----D-----------
SCYL1_Mmus       ----------------------------------T-HYCELVGA----N-----------
SCYL2_Mmus       ----------------------------------E-HVKLLLNV----T-----------
SCYL3_Mmus       ----------------------------------I-LHSALLNP----M-----------
W07G4.3_Cele     ----------------------------------E-LYKK-IGA----Q-----------
ZC581.9_Cele     ----------------------------------D-SMAKVLSL----D-----------
Scy1_Ddis        ----------------------------------Q-AYQKSFAV----K-----------
Scy2_Ddis        ----------------------------------A-KVCTILLG----D-----------
3125_Tthe        ----------------------------------E-DFKKLVSRMLAKNPSTSLFMYECM
SCYL2_Spur       ----------------------------------E-YVKMLLST----T-----------
SCYL3_Spur       ----------------------------------N-VEEQFLNP----D-----------
SCYL1_Spur       ----------------------------------P-NYCELVGA----N-----------
CG1344_Dmel      ----------------------------------EYCSTHLKHQ----N-----------
CC1G_05159_Ccin  ----------------------------------S-LVRSLVTR----H-----------
CC1G_02059_Ccin  ----------------------------------P-LFKKLLTP----N-----------
AqueK202_Aque    ----------------------------------S-HYLQCVNA----N-----------
AqueK203_Aque    ----------------------------------S-HYLQCVNA----N-----------
AqueK204_Aque    ----------------------------------S-HYLQCVNA----N-----------
AqueK205_Aque    ----------------------------------S-LVRSLLTI----E-----------
SCY1_Smoe        ----------------------------------H-DLKRMLSP----A-----------
GK067_Glam       MTQTINATEQVCLSQMEAAMPSLWAASREECDCGQ-MYTEFLSK----N-----------


SCYL3_Hsap       -------------PKCRPALCTLL-----SHDFFR------------NDFLEVVNFLK--
SCYL2_Hsap       -------------PTVRPDADQMT-----KIPFFD------------DVGAVTLQYFD--
SCYL1_Hsap       -------------PKVRPNPARFLQNCRAPGGFMS------------NRFVETNLFLE--
SCY1_Scer        -------------IYSRYDNITLI----LDSEFFQ------------DPLVKTLNFLD--
CG1973_Dmel      -------------PSNRPNPADIITRCRKPGGFFK------------NDLVDTLLFLE--
CG1951_Dmel      -------------ANLRPKLHELK-----QIAYFQ------------DVGVKTLSYLD--
CG14163_Dmel     -------------ATARPTAQLLQ-----LIKYFI------------DTPINALKFLD--
SCYL1_Mmus       -------------PKVRPNPARFLQNCRAPGGFMS------------NRFVETNLFLE--
SCYL2_Mmus       -------------PTVRPDADQMT-----KIPFFD------------DVGAVTLQYFD--
SCYL3_Mmus       -------------PECRPALSTLL-----SHDFFR------------NDFLEVVNFLK--
W07G4.3_Cele     -------------SAARLAVFSKISEYRLTGGYLK------------NKFVDTLLFLE--
ZC581.9_Cele     -------------VEVRPTVQLLS-----LIKHFD------------DPCLSALRQLD--
Scy1_Ddis        -------------TESRLNPQKFL-----ESPYFQ------------NVFVETLVFLE--
Scy2_Ddis        -------------PMLRGDLENFI-----RSSFFQ------------DVLTKTLLYLA--
3125_Tthe        LITDKQNFKFLNKIKNRPTIEQIK-----ESSWMN------------DPFVKAIYMLE--
SCYL2_Spur       -------------PTIRPDADQLG-----KVNT---------------------------
SCYL3_Spur       -------------PKFRPKLKTLL-----PDEIFK------------NDFLDIMSFLH--
SCYL1_Spur       -------------PISRPNPAKFIESCQNSGGFMK------------NSFVDTNLFLE--
CG1344_Dmel      -------------TKLRPRLSAIL-----LHPYFN------------HEFVLIHSFLF--
CC1G_05159_Ccin  -------------ATSRPTPQTLS-----SHPFFS------------SLPISTLNFLDRS
CC1G_02059_Ccin  -------------PATRATPKHFLEVGMTDGGFFA-----------NNPLVKICLGLD--
AqueK202_Aque    -------------PMARPNPSELLQSLKERGGYLS------------NTFISLNLKIE--
AqueK203_Aque    -------------PMARPNPSELLQSLKERGGYLS------------NTFISLNLKIE--
AqueK204_Aque    -------------PMARPNPSELLQSLKERGGYLS------------NTFISLNLKIE--
AqueK205_Aque    -------------PSVRPDSLQIA-----KHEFFD------------DVLVNGLRYIE--
SCY1_Smoe        -------------ELSRPTASEFT-----GSPFFR-----------EDTRLRALRFLD--
GK067_Glam       -------------SVARVANEIME-----LKKEMVFTASTPANSGDSNIMERTVQFL---
                                 *

SCYL3_Hsap       SLT-LKSEEEKTEFFKF-LLD-RV--SCLSEELIASRLVPLLLNQL-VFAEPVAV-----
SCYL2_Hsap       TLF-QRDNLQKSQFFKG-LPK-VL--PKLPKRVIVQRILPCLTSEF-VNPDMVP------
SCYL1_Hsap       EIQ-IKEPAEKQKFFQE-LSK-SL--DAFPEDFCRHKVLPQLLTAF-EFGNAGA------
SCY1_Scer        DLP-TKNNEEKYVFLEG-LVN-LL--PEFPPALLQKKFLPILLELL-SQFCAEKVVSDKC
CG1973_Dmel      EIQ-IKDKAEKNRFFSG-LTT-HL--DNFPDNVCRHKILPQLITAY-EYGDAGS------
CG1951_Dmel      SLY-QWDNLQKSKFYKG-LPQ-II--PTLPHRVNLHSILPYLVKEF-VNSPMIP------
CG14163_Dmel     VVN-MKDTQQKSQFYKTTLIE-AM--PMIPRKLWWQNIWPMLKSEI-NNNEVLA------
SCYL1_Mmus       EIQ-IKEPAEKQKFFQE-LSK-SL--DSFPEDFCRHKVLPQLLTAF-EFGNAGA------
SCYL2_Mmus       TLF-QRDNLQKSQFFKG-LPK-VL--PKLPKRVIVQRILPCLTSEF-VNPDMVP------
SCYL3_Mmus       SLT-LKSEDEKTEFFKF-LLD-RV--SCLSEELIASRLVPLLLNQL-VFAEPVAV-----
W07G4.3_Cele     EFE-LKEASEKQSFFMH-LRE-NI--DIFPEDVAKYKILPKLILTY-EYGDAGP------
ZC581.9_Cele     DIAQVFDPSQKSHFLSQTLNV-AI--PHISESVWFNRVLPRFNEQLLELPEMYY------
Scy1_Ddis        NIT-LKDTFEKEQFFKK-LDQ-HI--EKIPINICKFKILPHLVTAF-DLGPVNP------
Scy2_Ddis        NIS-QKEDESKLQFFRG-LLR-IV--QQFSPRIQNNYILPVLLSEI-SNDRIIY------
3125_Tthe        NIV-ELEQNKQISFLAG-MSN-IL--FKYEKPVIKRRIVPQLIDLA-KFEYLIP------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       KLV-LKSEVEKTVFFEG-LAP-HL--YRLPAQLVASRLLTPIMNSF-VMAEPVAV-----
SCYL1_Spur       EIQ-IKDQTEKTKFLSG-LSA-AI--DDFPEEFCRHRILPLLLQAF-EFGNAGS------
CG1344_Dmel      ELP-LKSVHERHKFFRS-LID-RL--RYFDEEVVASQLACDLLSRM-VLLDPAAQ-----
CC1G_05159_Ccin  NFT-AKTREEKISFMKG-LTG-VL--NRFSEGLQTRKILPSLLEEM-KDTHLLP------
CC1G_02059_Ccin  NFA-IASESEKATFLRT-LNE-SA--ASFPQELASKKILPSLLSAL-EFGGASA------
AqueK202_Aque    ELQ-LMEADRKNHFFVE-LNK-SL--DLFPDSFAHHKVLPHLLNVF-EFGGAGP------
AqueK203_Aque    ELQ-LMEADRKNHFFVE-LNK-SL--DLFPDSFAHHKVLPHLLNVF-EFGGAGP------
AqueK204_Aque    ELQ-LMEADRKNHFFVE-LNK-SL--DLFPDSFAHHKVLPHLLNVF-EFGGAGP------
AqueK205_Aque    TLV-EKSDIDKSQWFKGSLSR-II--TKYPKRLLHHRILPALGMEF-RNHKMIP------
SCY1_Smoe        HML-ERDNIQKSDFLKA-LSG-MW--TEFDPRVLRYKVLPPLCLEL-RNVVMLP------
GK067_Glam       ---------------TK-MLPICLEKRMLSVDLTMAAIWPRIVSML-SRRDIYR------


SCYL3_Hsap       -KSFLPYL---LGPKKDHAQGETPCLLS-PALFQS-RVIPVLL-----------------
SCYL2_Hsap       --FVLPNV---LLIAE---------ECT-KEEYVK-LILPELG-----------------
SCYL1_Hsap       --VVLTPL---FKVGK---------FLS-AEEYQQ-KIIPVVV-----------------
SCY1_Scer        VGKSLDLI---IKIGS---------TLS-QLSFQE-KVYPVLL-----------------
CG1973_Dmel      --AVLAPM---FKLGK---------LLD-EVEYQK-RIVPCVV-----------------
CG1951_Dmel      --FVLPNV---LLIAE---------MSS-QREYCD-HILPHLK-----------------
CG14163_Dmel     --AVLQPV---MLFVQ---------EAT-LTEYDT-LMSATMK-----------------
SCYL1_Mmus       --VVLTPL---FKVGK---------SLR-AEEYQE-KIIPVVV-----------------
SCYL2_Mmus       --FVLPNV---LLIAE---------ECT-KEEYIK-LILPELG-----------------
SCYL3_Mmus       -KSFLPYL---LGPKKENAPGETPCLLS-PALFQS-RVIPVLL-----------------
W07G4.3_Cele     --NILIPL---FKLGR---------LLD-EAEYQR-TIVPCLC-----------------
ZC581.9_Cele     --PITKPL---FHILE---------HCE-SHNI-H-KMKPWIR-----------------
Scy1_Ddis        --RLLSTL---LKIGS---------NLS-TEEYNS-RIVPSVV-----------------
Scy2_Ddis        --VLLPNI---MSISA--------NHVK-KETFQS-KVLPAIS-----------------
3125_Tthe        --PILNIVTDCVKQPD---------LYS-VSEFQS-DLQPFVV-----------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       -NM---------------------------------------------------------
SCYL1_Spur       --AILTPL---LKLGK---------LLD-GDEYQK-RIVPIVV-----------------
CG1344_Dmel      -EFVTPHI---LRTKVTD--KAPASLFS-PQIYVQ-YLMPHIL-----------------
CC1G_05159_Ccin  --YILPNV---FAISQ---------ALS-PTQFAS-MVLPSLK-----------------
CC1G_02059_Ccin  -AAILPLV---LQFGA---------NVS-PEEYTK-TIVDPIV-----------------
AqueK202_Aque    --TVLAPL---LKIGK---------LLP-EDEYQR-KIVPCIV-----------------
AqueK203_Aque    --TVLAPL---LKIGK---------LLP-EDEYQR-KIVPCIV-----------------
AqueK204_Aque    --TVLAPL---LKIGK---------LLP-EDEYQR-KIVSCIV-----------------
AqueK205_Aque    --FVLPLV---LLIAD---------DCS-IEEYST-LVLPILI-----------------
SCY1_Smoe        --MVLPMV---LTIAE---------SQE-KADFES-STLPALL-----------------
GK067_Glam       --YTVPLL---IQYSY---------MLEIPADQLYILLEPIVLACTLTDHRSKFPGTHST


SCYL3_Hsap       ------------QLF--E--V------HEE-H-----VRMVLLSHIEAYVEHFTQEQLKK
SCYL2_Hsap       ------------PVF--K--Q------QEP-IQASNMILLIFLQKMDLLLTKTPPDEIKN
SCYL1_Hsap       ------------KMF--S--S------TDR-A-----MRIRLLQQMEQFIQYLDEPTVNT
SCY1_Scer        ------------SDA--NFPV------LLK-K-----ATICLIDNLDTLKQKVKRSDFLE
CG1973_Dmel      ------------KLF--A--S------TDR-V-----TRSRLLQQLDLFIAHLQPQVVND
CG1951_Dmel      ------------PIF--K--L------TDP-IQ----ILLIFMQKMDLLLKLTPAEEVKQ
CG14163_Dmel     ------------VIY--N--T------PKS-IQ----ASVTILENLHLIIEKTKPEDVTT
SCYL1_Mmus       ------------KMF--S--S------TDR-A-----MRIRLLQQMEQFIQYLDEPTVNT
SCYL2_Mmus       ------------PVF--K--Q------QEP-IQ----ILLIFLQKMDLLLTKTPPDEIKN
SCYL3_Mmus       ------------RLF--E--V------HEE-H-----VRMVLLSHIEAYVEHFTQEQLKK
W07G4.3_Cele     ------------KLF--G--S------PDR-T-----TRVKLLERIDEFAPHLTPQILND
ZC581.9_Cele     ------------KLM--EAAP------HNK-L-----LRAFILENMSALFRRLSDEFVED
Scy1_Ddis        ------------KWF--A--C------DD---R---ALRINLLENLEHYIQHLNEATIND
Scy2_Ddis        ------------NIL--Q--S------KEP-KP---EVLSCVLENLPMLLQKCSLDQIKK
3125_Tthe        ------------GLT--K--R------KSI-PG---KALYALVVNCEHYFKVFDKTEFQN
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       ------------KLF--S--S------TDR-N-----TRVKLLQQMDQFIEHLQPAVVND
CG1344_Dmel      ------------KMF--R--L------RDA-Q-----IRLILLDYFMDYVRLLSDEQLES
CC1G_05159_Ccin  ------------PLF--A--I------KEP-PQ----NMLTLLDNLGMLQEKTEKNVFKD
CC1G_02059_Ccin  ------------KLY--S--S------PDR-G-----TRMALLDHLPQYIDKLDKKTVSD
AqueK202_Aque    ------------RSF--G--S------NDR-A-----TRLNLLQHLDQFIDQLQPSVLNN
AqueK203_Aque    ------------RSF--G--S------NDR-A-----TRLNLLQHLDQFIDQLQPSVLNN
AqueK204_Aque    ------------RCF--G--S------NDR-A-----TRLNLLQHLDQFIDQLQPSVLNN
AqueK205_Aque    ------------PAF--R--I------HDP-IQ----IPLIFLQKMDLLLKLTNPEERRQ
SCY1_Smoe        ------------PVL--S--S------ATG--E----SLLLLVKHAALLINKVTSEHLST
GK067_Glam       QQAWTSGIEVYGRLFMYQ--TPYMDIPMDKSTK----ERTKFIPNFDKQINTDQESVITT


SCYL3_Hsap       VI-LP-----------------------QVLLGLRDTS----DSIVAITLHSLAVLVSLL
SCYL2_Hsap       SV-LP-----------------------MVYRALEAPS----IQIQELCLNIIPTFANLI
SCYL1_Hsap       QI-FP-----------------------HVVHGFLDTN----PAIREQTVKSMLLLAPKL
SCY1_Scer        NILKP-----------------------LFNYVLHDSESDITVVCQEKLLSQIPLALEVL
CG1973_Dmel      QI-FP-----------------------QVAHGFLDTN----ATIREQTVKSIIHLAPKL
CG1951_Dmel      SV-LP-----------------------LLYRSLECDM----PQIQDLCLAVLPTFSTLI
CG14163_Dmel     DI-MP-----------------------MLFYSFDGST----IQVQSAAVVAVANVFDSI
SCYL1_Mmus       QI-FP-----------------------HVTHGFLDTN----PAIREQTVKSMLLLAPKL
SCYL2_Mmus       SV-LP-----------------------MVYRALEAPS----IQIQELCLNIIPTFANLI
SCYL3_Mmus       VI-LP-----------------------QVLLGLRDTS----NSIVAITLRSLAVLVSLL
W07G4.3_Cele     KI-FG-----------------------NLTSGFLDTN----PAVRESTVKAMVSLAEKL
ZC581.9_Cele     KC-LD-----------------------VIILSLKSED----TSLQSSAVRGLPHVAEYL
Scy1_Ddis        QI-FP-----------------------HVVNGFND-N----PTLKELTIKSMLLFAPKL
Scy2_Ddis        IL-LP-----------------------ICLGSMCGPT----NEIIFQCLSTAQPIAKFF
3125_Tthe        VY-LV-----------------------PVLKCFD--I----PQLQGYVLNQCDFLMSKL
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       -L-FP-----------------------HLLTPRRGKV----------------------
SCYL1_Spur       QI-FP-----------------------HICHGFNDTV----PVIRENTVKAMLLLASKL
CG1344_Dmel      EI-LP-----------------------HLQLGMNDTN----DVLVGKTLRCMADLVSIL
CC1G_05159_Ccin  HV-LP-----------------------LVYNALESEH----AIVQERALKAVPDLCETV
CC1G_02059_Ccin  KI-FP-----------------------HLQTGFADTV----AVIREATVRSISSFAPKL
AqueK202_Aque    SL-FG-----------------------QIVTGFTDTV----PTIREHTIKA--------
AqueK203_Aque    SL-FG-----------------------QIVTGFTDTV----PTIREHTIKASLLLAPKL
AqueK204_Aque    SL-FG-----------------------QIVTGFTDTV----PTIREHTIKASLLLAPKL
AqueK205_Aque    HL-LP-----------------------MILGAMESSS----SQVQELCMSILPTFADMI
SCY1_Smoe        SV-VP-----------------------MLVRAYDDPD----ARMQEEVLKRTIGIAKQI
GK067_Glam       VI-FVLLEYASFFTNKKVGARSHYSYLNFLVSCLSSKN----AMIQEKALAAIAACAPFI


SCYL3_Hsap       GPEV--------------------------------------VVGGERTKIFK-------
SCYL2_Hsap       DYPS--------------------------------------M-KNALIPRIKNACLQT-
SCYL1_Hsap       NEAN--------------------------------------L-NVELMKHFARLQAKD-
SCY1_Scer        DFPT--------------------------------------V-KQFLLPLLSNLFTKT-
CG1973_Dmel      NYNN--------------------------------------L-NVEVLRHFARLQARD-
CG1951_Dmel      DYNA--------------------------------------M-KNSVLPRIKKLCLQS-
CG14163_Dmel     DELS--------------------------------------I-RRMVLPKVKQVFEKNI
SCYL1_Mmus       NEAN--------------------------------------L-NVELMKHFARLQAKD-
SCYL2_Mmus       DYPS--------------------------------------M-KNALIPRIKNACLQT-
SCYL3_Mmus       GPEV--------------------------------------VVGGERTKIFK-------
W07G4.3_Cele     NYNN--------------------------------------L-NVELMKYLARLQGGD-
ZC581.9_Cele     PVGF--------------------------------------I-TKKLIPAIMGLPPFLH
Scy1_Ddis        QEKT--------------------------------------M-I-ILLKYFA-ALQKD-
Scy2_Ddis        DTDM--------------------------------------I-SVAVIPRLTNLCVGG-
3125_Tthe        DYQF--------------------------------------T-KSKLLPRILLLCTSN-
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       NDKN--------------------------------------L-NIELLKHFARLQAKD-
CG1344_Dmel      GANK--------------------------------------VLGGDRARCF--------
CC1G_05159_Ccin  DYAE--------------------------------------V-QGVLFPRVAVVFSKT-
CC1G_02059_Ccin  TERI--------------------------------------L-NNDLLRLLAKMQV-D-
AqueK202_Aque    ------------------------------------------------------------
AqueK203_Aque    NDSN--------------------------------------L-S-QLLKFFAKCQL-D-
AqueK204_Aque    NDSN--------------------------------------L-S-QLLKFFAKCQL-D-
AqueK205_Aque    DYTS--------------------------------------M-KHSIIPRITEICVKS-
SCY1_Smoe        DYQI--------------------------------------L-KQSILPRIHGLALKT-
GK067_Glam       GDVTCWMMDHSRESLMAGTAAQQAPEKQDNTISTFTDRYTQPF-VKSLTPKIIGLMGGS-


SCYL3_Hsap       -----------------------------R-TAPSFTKN----TDLSLEDSPM-CVVCSH
SCYL2_Hsap       SSLAVRVNSLVCLGKILEY--LDKWFVLDDILPFLQQ-IP---SKEPAVLMGILGIYKCT
SCYL1_Hsap       EQGPIRCNTTVCLGKIGSY--LSASTRHR-VLTSAFSR-A---TRDPFAPSRVAGVLGFA
SCY1_Scer        TSLTVKNTCVTCFQIMIEHKSIDSYTCSE-TVLPLFKSMK---TRDPRILSKLLKL--FE
CG1973_Dmel      DQGGIRTNTTVCLGKIAPH--LHPQVRQR-VLVSAFIR-A---MRDPFPPARVAGVLALA
CG1951_Dmel      SNVSVKVNCLISIGKLLEN--LDKWLVLDEILPFLQQ-IQ---SREPAIIMGIIGIYKIA
CG14163_Dmel     TDPKIVQNVLMCIERVMDR--MERAQVMDEVLPLLAN-IR---IPDPDIIMRTVRIYHKL
SCYL1_Mmus       DQGPIRCNTTVCLGKIGSY--LSASTRHR-VLTSAFSR-A---TKDPFAPSRVAGVLGFA
SCYL2_Mmus       SSLAVRVNSLVCLGKILEY--LDKWFVLDDILPFLQQ-IP---SKEPAVLMGILGIYKCT
SCYL3_Mmus       -----------------------------R-TAPSFTKT----SDLSPEGSPM-HVVCSQ
W07G4.3_Cele     EHGGIRTNTTICLGKIGHL--IAPAKRQG-ILISAFTR-A---LKDPFAPSRMASVLALS
ZC581.9_Cele     ENVPRQLDLLAALAALSD--RCDVSSIVH-LFGCISL-CN---SSHPVIVHAKSRIVQRL
Scy1_Ddis        QQAGVRCNTTICLGRITEY--MNEATKKRV-LIPAFS-TA---LKDPFVPSQNAAIQAFM
Scy2_Ddis        FPVHIRTKAIQWFTLLVPS--IEKKIIVDS-LLPNLEKILAGD-NSPVILQSLVETY--E
3125_Tthe        V-PKIMKQSIFTLKKIIPS--LDKHILNDQ-VLTTLDKLRKMTISDKSITMLILDIY--I
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       -------------------------------LGINLI-----------------------
SCYL1_Spur       EQGGIRTNTTICLGKLAGY--LNPTTRQK-VLSSAFVR-A---MKDPFPPARTAGVLSML
CG1344_Dmel      -------------SD----------G----RPHAAVSR-D---SNNPYPEPRSIS--PLM
CC1G_05159_Ccin  RILSVKVATLVTFLAMVKT--LDQSSLTQ-KLVPLLSKIR---TKEPSVMMATLDV--QE
CC1G_02059_Ccin  PEPSIRTNTCILLGRLGPT--LGYNTKKK-VLVPAFSR-A---LKDSFVHARVAALMAFT
AqueK202_Aque    ---GIRTNTTICLGKIAPH--LNSKTRDR-VLVSAFTR-S---LKDPFPPARSAGIGALG
AqueK203_Aque    EQAGIRTNTTICLGKIAPH--LNSKTRDR-VLVSAFTR-S---LKDPFPPARSAGIGALG
AqueK204_Aque    -------------------------TRDR-VLVSAFTR-S---LKDPFPPARSAGIGALG
AqueK205_Aque    SSESLRIKSLVAVGQMLDS--LDKGMIHENIIPAVYQ-IR---SREPGVLMAILGIIHKA
SCY1_Smoe        TIAAVRVNALLCLGELVPR--LDKNSFKE-VLQTLQR-CT---AVDHSAPTLMCTLGVAD
GK067_Glam       STDAMMGSCLRCLAVIIAY--LQDNDIAETVLPAIYG------MIDPIIKSPKAVVYFAE


SCYL3_Hsap       HSQ--IS-PILE-NPF--SSIF-PKCFFSGSTPINS--KKHIQRDYYN----TLLQTGDP
SCYL2_Hsap       FTHKKLG-ITKE-QLA--GKVL-PHLI-PLSI--EN--NLNLNQ--FNSFISVIKEMLNR
SCYL1_Hsap       ATHNL---YSMN-DCA--QKIL-PVLC-GLTV--DP--EKSVRDQAF----KAIRSFLSK
SCY1_Scer        TVPLI---ITDEIVLV--DQVL-PLMW-NYSM--AS--TLTKSQ--YSGYTKAINKMSSD
CG1973_Dmel      ATQQY---FLLS-EVA--NRVL-PSLC-SLTV--DP--EKTVRDPAF----KTIRGFLGK
CG1951_Dmel      MTNTKLG-ITKD-VMA--HKCI-PYLV-PLSV--EN--GLTIAQ--FNTIISLIKEMMGR
CG14163_Dmel     FVDKTYG-LTVE-TMA--TNVL-PLLI-PHTV--NP--SLNFEQ--YCYLLEVLQQMLEA
SCYL1_Mmus       ATHNL---YSMD-DCA--HKIL-PVLC-GLTV--DP--EKSVRDQAF----KTIRSFLSK
SCYL2_Mmus       FTHKKLG-ITKE-QLA--GKVL-PHLI-PLSI--EN--NLNLNQ--FSSFIAVIKEMLSR
SCYL3_Mmus       QSR--VS-KVLE-DPS--SNVF-PKWL-SGNVPSSS--RKRIQEECYS----SLSQTGDQ
W07G4.3_Cele     ATQQF---YPLV-EIS--NRIV-PSLI-PLTC--DP--EKQVRDQAF----KAIRGFLEK
ZC581.9_Cele     VMRDPNR-LKDSQLLS--IHLLNPLVN-GLAC--KDLSTFSCAH--FDDVLSSVRILLDV
Scy1_Ddis        FTISN---YSLE-ELA--TRVI-PEVS-RMLI--SP--EKSIRT----SAFTAINMFLQK
Scy2_Ddis        ALSKK---LGGE-LLA--KSVL-PALI-PLSS--DK--HIDLEQ--FKTVMKVIRDILNT
3125_Tthe        QISKS---LDIL-VIA--QKIL-PSLI-PYLI--DQ--SLGRKE--FDAYLNAVNAMIKQ
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------LVKM-PIFF-QVT-----------------------------
SCYL1_Spur       ATQSY---YSLK-DCA--LRVL-PTLC-TLTV--DP--DQGVRQNAF----KAIKIFLGK
CG1344_Dmel      NTRSF----DVE-DFMVSGSPL-PQES-NASP-------------------LSIRLSPDG
CC1G_05159_Ccin  AMGFK---VDRE-AVA--TLVL-PQLW-AMSM--GP--LLNVSQ--FQRFMSVIKKLGER
CC1G_02059_Ccin  ATIDC---FEIE-DLA--TKVI-PNMS-FALI--DR--EKVVRD----QAFKTLDLYVKK
AqueK202_Aque    STLSY---YTPI-DMA--TRII-PSLS-HMTV--DK--DQSVREQTF----KVLRLYVDK
AqueK203_Aque    STLSY---YTPV-DMA--TRII-PSLS-HMTV--DK--DQSVREQTF----KVLRLYVDK
AqueK204_Aque    STLSY---YTPV-DMA--TRII-PSLN-HMTV--DK--DKLIHYRYFYDFLKAIPHYTEV
AqueK205_Aque    FTSQTLG-FDKK-QLA--CKIL-PFLI-PLSI--EN--SLNVTQ--FNQFMMVIKEMLKK
SCY1_Smoe        ASYKQF---GVE-FAA--EHLL-PLLT-PLLT--AQ--QLNLQQ--FTKYMQFVKEILRE
GK067_Glam       FTQKVYTRCTAK-SIS--MLFL-PALL-KGIN--HP--GLETAQ----------------


SCYL3_Hsap       FSQPIKFPIN-------------------------------------------------G
SCYL2_Hsap       LESEHKT----------------------------------------------------K
SCYL1_Hsap       LESVSEDP-T-------------------------------------------------Q
SCY1_Scer        IQKHHIA----------------------------------------------------K
CG1973_Dmel      LEKVSEDP-S-------------------------------------------------L
CG1951_Dmel      VEQEQRE----------------------------------------------------K
CG14163_Dmel     IDRQQRN----------------------------------------------------K
SCYL1_Mmus       LESVSEDP-T-------------------------------------------------Q
SCYL2_Mmus       LESEHRT----------------------------------------------------K
SCYL3_Mmus       FSHTIKFPMN-------------------------------------------------G
W07G4.3_Cele     LEKASENP-A-------------------------------------------------C
ZC581.9_Cele     LEQRRYEM----------------------------------------------------
Scy1_Ddis        IEKNVDS----------------------------------------------------I
Scy2_Ddis        YEQERIN----------------------------------------------------E
3125_Tthe        IEAERKK----------------------------------------------------Q
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       LEKVSQDP-E-------------------------------------------------L
CG1344_Dmel      GEDEKL---R--------------------------------------------------
CC1G_05159_Ccin  VEREHDQ----------------------------------------------------F
CC1G_02059_Ccin  LEAHAAT-----------------------------------------------------
AqueK202_Aque    LEEHSKKM-E-------------------------------------------------P
AqueK203_Aque    LEEHSKKM-E-------------------------------------------------P
AqueK204_Aque    LRLSRDRS-TVYVAYHNRGCALFELAEKKKGEQYQFTKRGEFQFIAIGPDTVDMDYKHQP
AqueK205_Aque    IESDQRV----------------------------------------------------H
SCY1_Smoe        IEEKR------------------------------------------------------G
GK067_Glam       -----------------------------------------------------------D


SCYL3_Hsap       ---------------LSDVKNTS---EDSE-------NFP-SS-----------------
SCYL2_Hsap       ---------------LEQLHIMQ---E-QQ-------KSL-DI-----------------
SCYL1_Hsap       ---------------LEEVEKDV---H-AA-------SSP-GM-----------------
SCY1_Scer        ---------------LDDKVNDI---G-ED-------AFH-KV-----------------
CG1973_Dmel      ---------------RETMEADV---H-TA--------TP-SI-----------------
CG1951_Dmel      ---------------LQQLSTIQ---R-DN-------KPK-DA-----------------
CG14163_Dmel     ---------------LK-LDNLS---M-A--------S----------------------
SCYL1_Mmus       ---------------LAEVEKDV---H-AA-------SSP-GT-----------------
SCYL2_Mmus       ---------------LEQLHVMQ---E-QQ-------RSL-DI-----------------
SCYL3_Mmus       ---------------LSDVKNTS---EDNG-------SFP-AG-----------------
W07G4.3_Cele     ---------------IPELEAGV---K-AG-------ASS-ILD----------------
ZC581.9_Cele     ----------------EDRQEHK---Q-SN-------HH-L--G----------------
Scy1_Ddis        ---------------LPSSPQQQ---Q-QN-------GSTLNTN----------------
Scy2_Ddis        ---------------LSNLQRYT---S-PTPTKDENDTSFITVN----------------
3125_Tthe        ---------------IKDIEGGA---E-ES-------APAQNAN----------------
SCYL2_Spur       ------------------------------------------------------------
SCYL3_Spur       ------------------------------------------------------------
SCYL1_Spur       ---------------LEEMEADV---N-KA-------GSA-A------------------
CG1344_Dmel      ---------------LN---------S-NE-------KSI-SIKHNIDPEKDSYISGTEH
CC1G_05159_Ccin  ---------------LRDSQRLE---D-RS-------ATA-TM-----------------
CC1G_02059_Ccin  ---------------LPETANTD---G-PP-------NL---------------------
AqueK202_Aque    ---------------SSDGEGIE-------------------------------------
AqueK203_Aque    ---------------SSDGEGIE-------------------------------------
AqueK204_Aque    DEELDDYTTELYQQALKDLRKVIKNVD-S----------A-F------------------
AqueK205_Aque    ---------------LEQLAKME---E-QT-------KSTVSF-----------------
SCY1_Smoe        ---------------LKDGEAAK---E-GI--------SM-NG-----------------
GK067_Glam       ---------------LE--QIRR---T-C-------------------------------


SCYL3_Hsap       -----S------------------------------------------------------
SCYL2_Hsap       -----G------N---QM-NVSEEMKVTNIGNQQIDKVFNNIG-----------------
SCYL1_Hsap       -----G------------------------------------------------------
SCY1_Scer        -----IEPTIMKKEDPET-V----------------------------------------
CG1973_Dmel      -----G------------------------------------------------------
CG1951_Dmel      -----S------E---ILANELENSTLSPYGSIN----GNKIN-----------------
CG14163_Dmel     ------------------------------------------------------------
SCYL1_Mmus       -----G------------------------------------------------------
SCYL2_Mmus       -----G------N---QM-STSEETKVAHSGSQQIDKVFNNIG-----------------
SCYL3_Mmus       -----S------------------------------------------------------
W07G4.3_Cele     -----H-------------------------------