Protein (view, download) , Domain (view, download)
CC1G_11356_Ccin  MREFQTTKKRLNI-----------------------------------------------
CC1G_15178_Ccin  MCTDGEQRDAFLS-----------------------------------------------
CC1G_02847_Ccin  MPAHIHNYQ---------------------------------------------------
CC1G_04709_Ccin  MPRSRFLIF---D-----------------------------------------------
CC1G_06425_Ccin  MLRMITLIDLLND-----------------------------------------------
CC1G_00112_Ccin  MKGLNPNLVAAK------------------------------------------------
CC1G_04741_Ccin  MPSSVDIPPYFPPLF------WRLWFPPDVDQRARLHIYHVYDNELGEIEQQPQPSSS--
CC1G_03393_Ccin  MPPLQPPRAPS-DRVRIDSF-RTL--------------------------------SRLQ
CC1G_15177_Ccin  MSSKQTLETLHRR-----------------------------------------------
CC1G_09415_Ccin  MGRVSLQHS---------------------------------------------------
CC1G_02232_Ccin  MTSPPSDTSALTPRLRTTSLPQST--------------------------------SN--
CC1G_01227_Ccin  MYGSTSEESESEDS----------------------------------------------
CC1G_05652_Ccin  MASHPPISRL--------------------------------------------------
CC1G_13958_Ccin  MMAKDLVSGILGA-----------------------------------------------
CC1G_13961_Ccin  MSLKDLLVL---S-----------------------------------------------
CC1G_07742_Ccin  MASQQPQRQRSMA-----------------------------------------------
CC1G_06183_Ccin  MAAYILAAIAS-SL----------------------------------------------
                 *

CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  --------------------------------------------A---------------
CC1G_02847_Ccin  ----------------------------------------VDFHHDITPSAL--------
CC1G_04709_Ccin  --------------------------------------------SY-PN-----------
CC1G_06425_Ccin  --------------------------------------------HG-PK-----------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  --------------------------------------VFVHLFHNENGTPL--------
CC1G_03393_Ccin  LIFEFRVWLEYLRDHVPRRYDSPMIQLWDCMSFGAPICTLLDLLGSPTPVEL--------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  ----------------------------------------------PPFTPFPISLSFPI
CC1G_02232_Ccin  --------------------------------------SKSA--VTPQAAPV--------
CC1G_01227_Ccin  -----------------------------------------GMEIDLPSAPW--------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ----------------------------------------VELGAN--------------
CC1G_13961_Ccin  --------------------------------------------PV-PG-----------
CC1G_07742_Ccin  --------------------------------------------A---------------
CC1G_06183_Ccin  -----------------------------------------GFSASPPAAPL--------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  --------R--LSDR---------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  --------R--LSEDTQEMLERAGGIVSALEDDLLPH--------------LNALRF---
CC1G_03393_Ccin  --------R--VYADTFNFNLS--------MDERITF--------------IESFIHRIN
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  IRVTPPLFQDCS-TPKR-------------YPAF----------------------SL--
CC1G_02232_Ccin  --------A--TLSPSSE--SS--------SDDEFPD--------------LEAFRSRGQ
CC1G_01227_Ccin  --------HDDS-EPADEA--D--------EDEHLSDEQHELNSTDDHLLHWATFHQLNK
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  --------R--S-SPTLEA--N--------QNAERTSAQSKQTAHDSHP-----------


CC1G_11356_Ccin  ---------------------VFLGGRRVGK-------TSLLSQWSQGEFPSAYYPTFE-
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  --------------------DVHLEGRMIVL-----------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  --------------------------H----------------------L----------
CC1G_03393_Ccin  --------------------ILEIQGR----------------------IP---------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  -KFIQRVMSFRASPGGHGPKYLVNERCPPTAGAPDGSPIPFSRDWDHGEL-STHAPIVRA
CC1G_02232_Ccin  --------------------APSSQYH----------------------LP---------
CC1G_01227_Ccin  VKKDDLVRLYRA---ANLPEDPELLTKAEIITVIMDAR--------QDEL----------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  -----------------------LDAAVTIL----------TATW---------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  -----------------------------------NT-----------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  -----------------------------------------------------------R
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  RPGARGSPKPSTGSSFRSTASSAPIPIPMPTSASNAKLSSTRPSTHTVTSGGGAMVPPTR
CC1G_02232_Ccin  -----------------------------------------------------------R
CC1G_01227_Ccin  ------------------------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  --------------------------------VGKEVT----------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  RYPPQASRAPQV------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  REHPISSPPRQWNS-----T------------ADSEATHFAMDYSGQPSSPPVNRGTRIL
CC1G_02232_Ccin  KQYPRSSPAIKIDGAGTDVRRAQSASASLASSLGSDL-----------------------
CC1G_01227_Ccin  ASLPPSSPPGRTDAASSDYS------------SDEG------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  AGLSCDSPEVQGDAVD-DW-----------------------------------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  HGSPRKTNSSPPSHTFPNRVVVLGPSTSSHKHHHRPSNTGPGPGLGSSPLLDAGTLYGSQ
CC1G_02232_Ccin  ------------------------------------------------------------
CC1G_01227_Ccin  -------NVAGDEET---------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  DNLKY-HTHRA------IFLTK-------------AKDR-------RGRSVSPGRGKGHL
CC1G_02232_Ccin  ----------GFNIGRGR------------------------------------------
CC1G_01227_Ccin  -DAGPHYDAPG------RSLSMGNVMAPQSNGHQGLKRKASLRIQTE-------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------DS----------------------------------------------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  LPESFRPSTTVFDQRKLHPRPWSQLSIHSHIHAHGGTAIAGLEALWCSDN----------
CC1G_02232_Ccin  -------------------------------------------------SLSPSSNPRSR
CC1G_01227_Ccin  --------------------------ALSRPRTS--------------KD----------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------ED----------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  -SVPP---------------------------------------------------EQTE
CC1G_02232_Ccin  DISPTPSAGLDASWWALPETGA-------------------PPWKDQPKRKSSIPASEVD
CC1G_01227_Ccin  -SSPSTSALASS------STQSPPGHRLRSRKVSASTPVDVP--------------TP--
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  -SEPP---------------------------------------------------ED--


CC1G_11356_Ccin  -------------------------------------------FG---------NRIY--
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------TRVK--
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ----------------YGEVLKV---------DDFISGGVPGYVRVLRTLDRILNSLHDS
CC1G_15177_Ccin  --------------------------------------------------------LR--
CC1G_09415_Ccin  VFKQTEDSVKEALKSVTMLSIEVIVKILESG--VLEYVPIPGLNGVSKGLVKIWKVVK--
CC1G_02232_Ccin  GYDRTKERVALAVRSCLGNVVDVGHELLSIGVDLLELAPVPGLAPAARTLLNIWDAV---
CC1G_01227_Ccin  -TSAAS-KGRGK------------------------------------------------
CC1G_05652_Ccin  ---------------------------------------------------------QDV
CC1G_13958_Ccin  ------------------------------------VAGVPFAAGAALILKEIVDTC---
CC1G_13961_Ccin  ------------------------------------------------------NNVQ--
CC1G_07742_Ccin  --------------------------------------------------------FQ--
CC1G_06183_Ccin  -FSSEE-EGHGH------------------------------------------------


CC1G_11356_Ccin  --DCKVTDTAG-------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  --DAPLSYRQG-------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  YPGIFV-APQGWKARRASLIQQLKEAEAIHVSRLSDVAEAASRLYSQGDVTDPSLEGFIV
CC1G_15177_Ccin  --ECQC------------------------------------------------------
CC1G_09415_Ccin  --GVTNNRLRL-------------------------------------------------
CC1G_02232_Ccin  -DGVDV------------------------------------------------------
CC1G_01227_Ccin  ------------------------------------------------------------
CC1G_05652_Ccin  AP-------------------------------------YAS------------------
CC1G_13958_Ccin  -DQLRIHKKKA-------------------------------------------------
CC1G_13961_Ccin  --NVKVYKQQC-------------------------------------------------
CC1G_07742_Ccin  --SC--------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  ---------HDRYTPLSPTHVVGMHVFVLVYSFEDAGSLELVSALYEKILE-------FL
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ---------WA----------------------------ESSAAL-HITKA-------WL
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  NCSRLIPYHNIFYQPLGELPPPGEEIWDDIFMFSD---------------KLLRTNIIRA
CC1G_15177_Ccin  ---------GEVSL-------------------------EL---LHEKPAT-------WI
CC1G_09415_Ccin  ---------LRLT-----------------------------------------------
CC1G_02232_Ccin  -----------------------------------------------------NFNRCLR
CC1G_01227_Ccin  -----------GK-----------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ---------RT-------------------------------------------------
CC1G_13961_Ccin  ---------HDLS-----------------------------------------------
CC1G_07742_Ccin  ---------SQF---------------------------YV---I--DSHI-------WV
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  GS------TRHARVI----MAGNKADTSRREISYPEAHQLAQKLGCPHLILSSYWWQSID
CC1G_15178_Ccin  ---------------------QD-------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  GA-------------------------------------------------------ALS
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  -----------------------------------------------------TNTFSFP
CC1G_03393_Ccin  ------YHSLCANYL----PLVDTLSKL--------------------------------
CC1G_15177_Ccin  GHHRDDIAAICAAYSECYPILKDEGIS--EMLFPRTFILAAVVLGSSEENTRSVASRLKV
CC1G_09415_Ccin  --------QRCAHLL----LSIKKDVES--------------------------------
CC1G_02232_Ccin  ------LADRCARLL----ISIREEVRE--------------------------------
CC1G_01227_Ccin  --------NKQVEFS----T----------------------------------------
CC1G_05652_Ccin  --------------------IIK---RF--------------------------------
CC1G_13958_Ccin  ------IRNKCVQFT----LLLDDHSRT--------------------------------
CC1G_13961_Ccin  --------TRCTMLI----LALNEGMQN--------------------------------
CC1G_07742_Ccin  ------INGDCINYR---TLGRDEASN--SRTMPSTFSMQRTAAAEQVAVTNSPAPWIYT
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  ----QLFEECTIGGERRNRQPPTRTSATAKPQSRGLWFPS-IDLLSSLLRY-----A---
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ---HAKFRSCL---------------------------LAMLQFLES-LPF-----T---
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  SNSLSKLRRYL-------------------------T---FIRFRNS-------------
CC1G_03393_Ccin  ----------------------------------------------R-SRHLEYADDADM
CC1G_15177_Ccin  -SSFAHRRSYL-------------------------VFSALREILDA-GRG-----L---
CC1G_09415_Ccin  ----------------------------------------------A-GER--VHSS---
CC1G_02232_Ccin  ----------------------------------------------A-GDA--VGEE---
CC1G_01227_Ccin  ----------------------------------------------E-IVQ--VKST---
CC1G_05652_Ccin  ----------------------------------------------E----IN-------
CC1G_13958_Ccin  ----------------------------------------------N------IDAE---
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  SASFGEVRLAL---------------------------GCISEVIRF-------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  -----SRV----TWPSSAA-NTT---S---IPE--PTDTYH------QIQR-----HTKP
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  -----ARMARDRDFVELLD-QIQ---S---LPL--SEEEST------IYNR-----LMSP
CC1G_00112_Ccin  ---------------KAVERELT---LIRG-----------RMDKWSRMGK-----IKSF
CC1G_04741_Ccin  -----------AGYSTLIR-RLH---A---TPHHQGPGDPT------IYSEAFRP-----
CC1G_03393_Ccin  VLRHLSF---ILGRISDYREILQAILEVSM-----------PMNKDSYDSL-----CRMT
CC1G_15177_Ccin  -----DRV-----------------------------------------AR-----LAAY
CC1G_09415_Ccin  -----L-----QNALDALQHAFD---KVRL-----------LAESQIETPF-----LQRL
CC1G_02232_Ccin  ----------LRDPIAALEEVFL---HVLE-----------FMRKQVRRPF-----LKRF
CC1G_01227_Ccin  -----SR----RSSQKEKDRQRE---QAEALAE--ESDLTDLDDALPVPTSRPQPSPRRL
CC1G_05652_Ccin  ----------------RSR--AKV------------------------------------
CC1G_13958_Ccin  ----------LLKSIDETRAIFE---RVYS-----------RMHRYSQMSA-----WSLF
CC1G_13961_Ccin  -------QHQSNDWATELENVVR---A---INA--KVQEWA------RLNR-----LKSF
CC1G_07742_Ccin  -------------------------------------------------SQ-----IKGL
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  HSE-EELHGS-------------------------------QAPIPITTPLDYDRPTRS-
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  SAR-HDTSPP-------------------------------QGPVHDSRERVYDVK--S-
CC1G_00112_Ccin  LSQ-DDVSRE-------------------------------IMEC---------------
CC1G_04741_Ccin  --------------------------------------------YLIRTKRRYLLK--CF
CC1G_03393_Ccin  FEM-YQLSES-------------------------------IDEA---------------
CC1G_15177_Ccin  RT---------------------------PKDGLRRILLSETAPTPGFIPRN--------
CC1G_09415_Ccin  VGG-GNIDAE-------------------------------FVQC---------------
CC1G_02232_Ccin  LKR-DETQED-------------------------------IDEC---------------
CC1G_01227_Ccin  RSK-DRGRTH-------------------------------IDSK---------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  LKM-SEIGEG-------------------------------LDEC---------------
CC1G_13961_Ccin  LQQ-SEIQEA-------------------------------LHRF---------------
CC1G_07742_Ccin  YSHTRELAEVVVLAEKAYKACRGIDIASLVQRGIKECISGLAQCLPGIF-----------
CC1G_06183_Ccin  ----GEVQMQ-------------------------------MEES---------------


CC1G_11356_Ccin  ---SVRGY--------------SIMSTSSG------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  --------------------------------R-------------LK------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  --VALGNNSVSKDSTVQADE--EMISSNESEIT-------------ADDIFSQFRVDDIA
CC1G_00112_Ccin  ------------------------------HTA-------------ISDCISKF------
CC1G_04741_Ccin  IDFLEGNDA-----------------------R-------------SR------------
CC1G_03393_Ccin  ------------------------------GFELRTIWAARCLKMRLGNTLRSF------
CC1G_15177_Ccin  --VVDANFQAPRTSLRPMVNELLLLETAHIA-----------------------------
CC1G_09415_Ccin  ------------------------------DEE-------------LNEALRMF------
CC1G_02232_Ccin  ------------------------------NKR-------------LDDATKLF------
CC1G_01227_Ccin  ------------------------------SRE-------------SDDADHTP------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------EAN-------------VQSAIEMF------
CC1G_13961_Ccin  ------------------------------HRR-------------LDGAMDRY------
CC1G_07742_Ccin  ------------------------SELMHIA-----------------------------
CC1G_06183_Ccin  ------------------------------WSR-------------LGVVPTRR------


CC1G_11356_Ccin  ------------------------------------------EATL-VSTFG-PKSRLSA
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  IYL---------------------------------------ETTM-RMLRA-PQSGW-S
CC1G_00112_Ccin  -QL---------------------------------------QSQI-EIFEWQKEHEANT
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  -SS-----------------------------------------EG-LGT----------
CC1G_15177_Ccin  -------------------------------------------AL-------V-------
CC1G_09415_Ccin  -SL---------------------------------------SVQI-STMKLVVETSDGL
CC1G_02232_Ccin  -TT---------------------------------------SIVI-RILRKTYEMDAQR
CC1G_01227_Ccin  -TSKSRSAKAMPQSHSKPQPKRVTPMRKAKGKIKSLKESETEASHEEDGSENSEEDEEGQ
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  -QF---------------------------------------AAHA-VGNRNQQEIKETM
CC1G_13961_Ccin  -HI---------------------------------------AATL-EFRRGLYESRA--
CC1G_07742_Ccin  -------------------------------------------FL---------------
CC1G_06183_Ccin  -DT---------------------------------------------------------


CC1G_11356_Ccin  SSS-----------------KGRVRGVDAGLAQDFTNLFRS-------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ---------------------------EADCAYMIHSIFQK-------------------
CC1G_00112_Ccin  ------------------------------------------------RLDHQEL-A---
CC1G_04741_Ccin  ---------------------NHLQGVDLSPDNKFVGLVRE-------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  -----------------------VDCIEQGPGQDT-------------------------
CC1G_09415_Ccin  ------------------------------------------------RQQNEEL-M---
CC1G_02232_Ccin  ------------------------------------------------QKDTRAI-IKTI
CC1G_01227_Ccin  -EVEMEMEEDDGEGEMEEDQDADVQGGDTGEEDEVDELVSSASITPPPSNTYARKTP---
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------RVQHEEM-R---
CC1G_13961_Ccin  -------------------------ILERDKAEMR-TVLQQ-------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  --------------------------------------------------------G---


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ---------------------------------VMDIYCWRLLEAEICVGVA--------
CC1G_03393_Ccin  --------------------------------------------ALLDD-----------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  ---------KMMHGRNLSQSSLGHPQSFKRRGSVNRSPSPNYRLSE--R-----------
CC1G_02232_Ccin  ISSSIPQTDPPLS-------------------PIL--------LSPEDN-----------
CC1G_01227_Ccin  ---------LRQR-------------------LRR--------RPC--ATTAELDAEENE
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ---------ALLR-------------------E---------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ---------ATIR-------------------PSR--------FSP--S-----------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  -TDEQEY-----------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  ------------------------------------------------------------
CC1G_02232_Ccin  ------------------------------------------------------------
CC1G_01227_Ccin  GDDEHEEDADGDDDDTETVDGHDGDEGEDDESTIAVEPRRLRNGKIVGDEEAHMDEDDGG
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  -----------------------------IMEDK--------VTL-KTL-----------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  -----------------------------ALDTR--------ESY-QYM-----------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------ILPDCCYGALDE
CC1G_03393_Ccin  --------------------------------------RLVVDPVSGD------------
CC1G_15177_Ccin  ------------------------------------------------L-----------
CC1G_09415_Ccin  --------------------------------------RPSTSDSRRSS-----------
CC1G_02232_Ccin  --------------------------------------RPTDDPSKEK------------
CC1G_01227_Ccin  SAEGGEEEAEESEETEGEPITVDETEEEAEEDTMEDEVDLSVATA-KTL-----------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  -----------------------------VLT------KPS--EA-REI-----------
CC1G_13961_Ccin  -----------------------------IARDN--------SDL-RSL-----------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  --------------------------------------SPSDSQS-ESI-----------


CC1G_11356_Ccin  ------------L-E--FRGHD----AQVVLN-ALQWV-------L--------------
CC1G_15178_Ccin  -------------------PAV----DQELAD-LLYSV-------L--------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------L-S--LTGND----AQLVLD-ALHFL-------L--------------
CC1G_00112_Ccin  --------------MG-ENKQI----AEAI------------------------------
CC1G_04741_Ccin  GFDEDREKCDFFF-P--ISPAI----SVYLLG-SSCFDDEPSFAPS--------------
CC1G_03393_Ccin  ---------------------------HYSVF-LFQSL-------LICCKERSSEARTAD
CC1G_15177_Ccin  ------------FLK--KDPEV----DQNLID-LFQGL-------L--------------
CC1G_09415_Ccin  ------------MA---ES-----------RSS---TP-------S--------------
CC1G_02232_Ccin  ------------------------------------------------------------
CC1G_01227_Ccin  ------------VR---LR-----------RD-DLVKL-------C--------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------IAMQRSGSQV----AQQVMQ-AGQEQLRNELMIS--------------
CC1G_13961_Ccin  ------------LSE--TSGKP----LEEIME-HFQTE-------L--------------
CC1G_07742_Ccin  --------------S--DGANLQSSLLGGIVQ-RW-------------------------
CC1G_06183_Ccin  ------------LG---HA-----------YSSSSCSG-------V--------------


CC1G_11356_Ccin  -----------------------------------------------D----------SR
CC1G_15178_Ccin  -----------------------------------------------G----------SR
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  -----------------------------------------------A---------YTP
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------EQ----PSSVSIHIGPESAI------------------D--VHL--RN
CC1G_03393_Ccin  VRYPMKAWELGPALSGTCPLSIVCAVPTKNLMTIHCFDAAYFELFWVDGSNTEQSITFYP
CC1G_15177_Ccin  -----------------------------------------------D----------YP
CC1G_09415_Ccin  ------------DLHRSMSLAQSGSIHRPTASSRNKQVIPIAKTVSEP----------VH
CC1G_02232_Ccin  ------------------PAPVTHFITTSNA----------------------LGL--SE
CC1G_01227_Ccin  -----------------------------------------------E----------TR
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  -----------------------------------------------N----------TR
CC1G_13961_Ccin  ---------------------------------------------------------MDP
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  -----------------------------------------------A----------SR


CC1G_11356_Ccin  KA---------QPAD---------------------------------------------
CC1G_15178_Ccin  HL---------DPV----------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  SL---------PPPD---------------------------------------------
CC1G_00112_Ccin  --------------Q---------------------------------------------
CC1G_04741_Ccin  TMVLQTYPPYLIFSS-----------------------------------------LRGI
CC1G_03393_Ccin  TMPQ--------------------------------------------------------
CC1G_15177_Ccin  AL---------KSI----------------------------------------------
CC1G_09415_Ccin  HH---------TPN-RGSVARRTSTRRPGSFGSGKEVLGSSPRSRYHPELEDPIEKIKQY
CC1G_02232_Ccin  TIDISTIPPDNV-----------------------------------------IPLLNSL
CC1G_01227_Ccin  NL---------EPIGT--------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  SE---------SPTR---------------------------------------------
CC1G_13961_Ccin  EI---------PKPQ---------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  HC---------YPL-R--------------------------------------------


CC1G_11356_Ccin  --------------------------------K---------------------GMLL--
CC1G_15178_Ccin  --------------------------------H---------------------APIL--
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  --------------------------------R---------------------RQIL--
CC1G_00112_Ccin  --------------------------------Q----------------------GLS--
CC1G_04741_Ccin  SLSVSSYYEFRWINEHQDYSRLRMRCRQKFMME---------------------GV----
CC1G_03393_Ccin  -------------QYTQWVANLQLFVTRILH-S-------------TSVPNMEGDDIGTG
CC1G_15177_Ccin  --------------------------------H---------------------PMIL--
CC1G_09415_Ccin  QRLQNEL------DRQSDLNDMKQIIRETLA-E-------------GKD-----SLVI--
CC1G_02232_Ccin  QESQNSL------DRTNDIASLRQLMLKAIQ-A-------------SSDAEMI-------
CC1G_01227_Ccin  --------------------------------K---------------------PQLA--
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  --------------------------------EGRDQEATTQKRRPG-------SDIR--
CC1G_13961_Ccin  --------------------------------K---------------------DDFR--
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  --------------------------------R---------------------GSTI--


CC1G_11356_Ccin  ------------------------KLLLRLSKHSG-------------------------
CC1G_15178_Ccin  ------------------------RALLKLSENTD-------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------KALQRLSNRSQ-------------------------
CC1G_00112_Ccin  ------------------------LNLYQLQKQSS-------------------------
CC1G_04741_Ccin  -------------------VKTL-VIRESVESNGE-------------------------
CC1G_03393_Ccin  GIRTGTSFVLTAEETMYEPRRSTARAWSVIGRKGPNSESSSLVAEMGNSPGEQGSILSPN
CC1G_15177_Ccin  ------------------------RALIHLVKEAA-------------------------
CC1G_09415_Ccin  -------------------------KLLQ--IDSR-------------------------
CC1G_02232_Ccin  ------DMLQVKHEQMPDAIKTLQRALETIEKRRNQSPLDT-------------------
CC1G_01227_Ccin  ------------------------EALLQWRDRHA-------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------DALYQFHLQTG-------------------------
CC1G_13961_Ccin  ------------------------FGLWWLHSRSS-------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  -----------------SY-----------------------------------------
CC1G_15178_Ccin  -----------------LL-----------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  -----------------LY-----------------------------------------
CC1G_00112_Ccin  -----------------E------------------------------------------
CC1G_04741_Ccin  -----------------SQPP-------------AS--PDSP-VR---------------
CC1G_03393_Ccin  LLP-------TLFTPSRNGES-------------VPASPNTP-ASGNN------------
CC1G_15177_Ccin  -----------------LF-----------------------------------------
CC1G_09415_Ccin  -----------------DYPQ-------------A------ILVLEHELREYQTGRKGNI
CC1G_02232_Ccin  IPPGVVIGKVKRRYSLKSGDNQEGGLQRSKTVLSIESTTSSK-STGGS------------
CC1G_01227_Ccin  -----------------NGSS-------------C------P-SSTGT------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  -----------------KL-----------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  PRLPNGRNRSRTRPDFQSARS---------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  AGEGG-------------------------------------GSD-EREEHAKLQIDLLQ
CC1G_02232_Ccin  SSAGGGSKRTRDTLEQEFIES---------------------------------------
CC1G_01227_Ccin  VRPPSTATTSRRRRKKQSSSSSVPVLLRSQKVHDDEPRTPVPGKEAKDKENDELELDLES
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  --------------------------------------------------------DL--


CC1G_11356_Ccin  --------------------------------PPCLALK-GIKREDDYPVTSGHFGEVWR
CC1G_15178_Ccin  --------------------------------PQRLAH-NSLQVAGGPPIHSTRISKIHR
CC1G_02847_Ccin  ---------------------------------------AQLD---MPYRDCGPYTDVLD
CC1G_04709_Ccin  --------------------------------ARFKNLSGRIRILDQQKVANGGFSDVYL
CC1G_06425_Ccin  --------------------------------PACLALT-NVERE-PHPIASGHFGEVYK
CC1G_00112_Ccin  ------------------------------LLPNRNLSSGEVKRIGEFPVAGTATMDIYE
CC1G_04741_Ccin  --------------------M--ESPPGK-DEVRVFDLTDEVQLKGNWAVAFGTFSDVWE
CC1G_03393_Ccin  -PLRSVFTRDDISPLNNAGRLGSAAPLEE-GLPETLDLTGQITREGNYAVAHGGHSDVWL
CC1G_15177_Ccin  --------------------------------PRCLVH-QDVNIPGQRCTAIGSFGDVWK
CC1G_09415_Ccin  RGIDAMK------------RM--TKQEDLANIPEWAINKFKII-E-LETIGYGSFSTVRR
CC1G_02232_Ccin  -GISALV------------RM--SQGQNT-NLPSWTITKFEINRE--KKIGVGGFSDVYR
CC1G_01227_Ccin  L-----------------------------GLEDREIPPEKIQ-K-LEKIGSGGFKDVFI
CC1G_05652_Ccin  ----------------------------------VLDL--------DATFARGSLSKVFV
CC1G_13958_Ccin  ------------------------------TLPAIKILNEEITRRSDHAVAGGTHSDIWE
CC1G_13961_Ccin  --------------------------------PPLPDLTGQVTKESEHVAFFGTFNDIYK
CC1G_07742_Ccin  ----------------------------------------------------------WN
CC1G_06183_Ccin  -------------------------------VTEALDLSAEIEIC-GGSVAHGGYSDVYR


CC1G_11356_Ccin  GRYQK------------------------------QKVCLKVVRVYQ--RSD-VEHFLRI
CC1G_15178_Ccin  GKVDD------------------------------RVVAVKVSNHSP--ELELGEYLNKA
CC1G_02847_Ccin  ATH----------------------------NLNCQKAVVKVFRIGKLS-PHHRHVLTKR
CC1G_04709_Ccin  GELVSR-------------------------LRPTRMVAVKALRGVHLRGAEARAKLIQR
CC1G_06425_Ccin  GYFEG------------------------------KVVALKLIKMYE--RTK-ASVITKA
CC1G_00112_Ccin  GLYLG-----------------------------KEKVSMKAIRAMKAD---E--KSRHR
CC1G_04741_Ccin  GTWKDPI------------------------EKRDTAVAVKFLRQAMVK--NVKERLIRR
CC1G_03393_Ccin  GRLKKQAD----------------------DSDQEVKVAVKVLRNTTSD-PEKKAKLVGR
CC1G_15177_Ccin  GDLRG------------------------------QAVAVKVMRQHV--TGIPVDSIIRG
CC1G_09415_Ccin  GLWNG------------------------------RTVAIKILSPKT---------KRTV
CC1G_02232_Ccin  GTWKG------------------------------RTVAIKVLKMET-----E----KKL
CC1G_01227_Ccin  GKFRG------------------------------RRIAISEFRGQL----------SAM
CC1G_05652_Ccin  GTIYVNG-------------------------QAPSKVVAKFLHAGPEY-P--QSQ--LF
CC1G_13958_Ccin  GLWLG-----------------------------RKKVALKGLRNIKAD--DP--RAKLR
CC1G_13961_Ccin  GRWLN-----------------------------EKMVALRLPRSLP--N---TPRLQRR
CC1G_07742_Ccin  SNQ---------------------------------------------------------
CC1G_06183_Ccin  AKWTTTTGSVTGNGNWIVNGDGVSAGAGKGEEVVTRDVAVKTLRAFSQTSNVDLNRARKR
                 .

CC1G_11356_Ccin  FSREAVIWSQ----LKHDNVLP-FYGVYE------LDE--SRRLCLVSP-----WMDNGS
CC1G_15178_Ccin  FKREAIIWSQ----LHHPNVLP-FYGLFQ------AE--GEHFYSLLSP-----WMDNGN
CC1G_02847_Ccin  LENVLAEWKKH---HTHPNISR-VTGMVL------GFW---DLPGIEMP-----LYSNGN
CC1G_04709_Ccin  LYREAGLWCS----LNHPNVLP-FLGLSE------ESI-CEGCPALVSP-----YCRNGT
CC1G_06425_Ccin  VLHEVVIWCQ----LVHRNVLP-FLGIHE------SEE---GWISLVSP-----WMRHGS
CC1G_00112_Ccin  FNREGEIWAKVWQKDRGQYIVP-FYGFCQ------TDG---PFPYMVSP-----WQENGD
CC1G_04741_Ccin  IQAEVATWHK----LCHRNVSQ-FFGIVQ------SAN----SFGMVSP-----WYCNGI
CC1G_03393_Ccin  LQHELRVWKQ----LDHMHVLP-LYGVTN------DFG---PYPSMVCP-----WMEKGS
CC1G_15177_Ccin  YGREAILWSQ----LHHPNVLP-FYGIYL--WPSEDS--GPTWVCLLSP-----WMANGN
CC1G_09415_Ccin  FENEMRIWRT----LSHPNILP-LYGGSN------ST---EEPLFFVSL-----YARYGN
CC1G_02232_Ccin  FIREVEIWKT----LHHPHVLE-LYGASS------ALE---PPWFFVSP-----YQKHGS
CC1G_01227_Ccin  DIKELKLLGG----FDHPNIVR-FLGVSI------PENTKETPVMIVSE-----LCSNGD
CC1G_05652_Ccin  LASEVSTVSH----LIHPNVAR-FHGLWW------QTE---FPASFIHPGIVVEFV-DYD
CC1G_13958_Ccin  IEREIKTWS----SLQNEHILP-FYGIVT------DIG---THIHMVSP-----WQENGN
CC1G_13961_Ccin  FEEEVKIWRK----LNHPNVLT-LYGITK-------I---GQYVYLVSP-----WMDNGT
CC1G_07742_Ccin  KEEEISTLRE----KVQKHLENLFHWLKWVMFLSLED--GSHFNPEI-------------
CC1G_06183_Ccin  LNREVHVLKR----LNHPNIAE-FYGIAF------HK---DGRPSVVMK-----WYRYGT
                                    :   .

CC1G_11356_Ccin  LREACPI-----------------------------------------------------
CC1G_15178_Ccin  ITDFLKAE----------------------------------------------------
CC1G_02847_Ccin  ASNYLKAL----------------------------------------------------
CC1G_04709_Ccin  VFEYVQAY----------------------------------------------------
CC1G_06425_Ccin  LPRYLSQK----------------------------------------------------
CC1G_00112_Ccin  ALTYVKANDH--------------------------------------------------
CC1G_04741_Ccin  ISEYVRKN----------------------------------------------------
CC1G_03393_Ccin  VSKYLEHSGDI-------------------------------------------------
CC1G_15177_Ccin  LSQYLEAR----------------------------------------------------
CC1G_09415_Ccin  LVDFLQAIRQNDLDGVFGAMLKERESGRGTGSTLKDSNPVGGARKRYSGGGGVSGS----
CC1G_02232_Ccin  LVDYLKKVGRDLQDPALTPTFRPDRSPRKTST-----------------------IPLPL
CC1G_01227_Ccin  LFDYIRNVSA--------------------------------------------------
CC1G_05652_Ccin  LLEYTKARPG--------------------------------------------------
CC1G_13958_Ccin  VLDYLKKQP---------------------------------------------------
CC1G_13961_Ccin  AINYIQKN----------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  APEYLAKN----------------------------------------------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  ------------------------------------------------------------
CC1G_09415_Ccin  -------PGTKEMREQAHHNRWQGVERERERSSGISSSTDGTAEPL-------HTLPLSK
CC1G_02232_Ccin  RSNRATSPT---------PQRS----------------------PLSALGPNTAKA----
CC1G_01227_Ccin  ------------------------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  ------------------------------------------------------------
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  -------------------------------------FI--SREW---------------
CC1G_15178_Ccin  -----------PQTD-RQELIFDIARGLEYLHNLDPPVIHGDLKPVCLFIVAGAMFTHRP
CC1G_02847_Ccin  -----------PNVD-KHRLICGIAEGLNHLHSQQPPIIHGMVCA---------------
CC1G_04709_Ccin  -----------PHIN-RLPIIRGIANGLQYLHSQ--TVVHGDLKV---------------
CC1G_06425_Ccin  -----------PNAN-RLLLISDVASGLAYLHEH--GVVHGDLKG---------------
CC1G_00112_Ccin  ------------KIN-YRDFIKRIALGVQVLHTCDPPIVHGDIKS---------------
CC1G_04741_Ccin  -----------PGVD-RLKLLIQVASGIGHLHSFSPPIVHGDLKG---------------
CC1G_03393_Ccin  ----------LDISE-RLRIIGEIMEGLQYLHLC--SIIHGDLTG---------------
CC1G_15177_Ccin  -----------PALD-RMPLVRDIARGLNYLHSLDPSFIHGDIKS---------------
CC1G_09415_Ccin  SESKFNHCHILKEGD-LYGFMVDIAKGMEYLHEN--GVLHGDLKA---------------
CC1G_02232_Ccin  --PLREEFKVRSEWD-LLRFMHEIAKGMEYLHSR--GVLHGDLKA---------------
CC1G_01227_Ccin  -----------PSLHKVLTMMLDIARGLEYLHMRKPSVIHRDCKS---------------
CC1G_05652_Ccin  --------------E-RIRVLRGGVLALQYIHQQ--GITHGDVHP---------------
CC1G_13958_Ccin  ------------NVN-RLRIIKGAARGLAYLHSM--KIVHGNVKC---------------
CC1G_13961_Ccin  -----------PNVD-RLGLLEQITSGLEYLHSQ--NIVHGDIRG---------------
CC1G_07742_Ccin  --------------------------LFRFLESRTPSPRHLRI-----------------
CC1G_06183_Ccin  -----------AGVD-RLGVVRDVAAGLEYLHTLQPPVVHGDLKG---------------


CC1G_11356_Ccin  --SMAIL--KGSGRACIADF----------------GLSSLVDGEM--LRW------TTS
CC1G_15178_Ccin  PKNNIFV--TANKRACIGDF----------------GLGKLPRDPK--W--------G-I
CC1G_02847_Ccin  --TNILI--SDSGAPLLTDI----------------GLGTIPLEAV--GVS------PFQ
CC1G_04709_Ccin  --DNILM--SDTGQPLLCDF----------------GRSKFETR----------------
CC1G_06425_Ccin  --VNILV--SPSGHACLADF----------------GLAKIADNEI--ISW------TSI
CC1G_00112_Ccin  --RNILI--NEEGHPRLTDF----------------GLSQIINDVS---G--------TP
CC1G_04741_Ccin  --GNILI--DACGAAIITDF----------------GLSKVMEETL--TEVCEEDGGAVS
CC1G_03393_Ccin  --SNILL--DTNLTAYVCDF----------------GLSAVVLDTD---TH-------TR
CC1G_15177_Ccin  --NNILV--TPSGTACLADF----------------GLGRLAPDAR--L--------G-W
CC1G_09415_Ccin  --SNVLV--NDDLTCVISDF----------------GQSERRNDIY---R----------
CC1G_02232_Ccin  --ANVLV--DDSYRCVITDF----------------GQSEMRSTAF---R----------
CC1G_01227_Ccin  --SNILI--TAKGVAKIADF----------------GLAKVKQSTR--------------
CC1G_05652_Ccin  --GNIRV--DAKGNAKVIDF----------------GLAQIQNM-G---GF-------P-
CC1G_13958_Ccin  --TNILV--MDNGEACICDF----------------GMSKLIEEVT---E--------KA
CC1G_13961_Ccin  --ANILI--SENGVALLADF----------------GLSKFLGDIG----T-------VA
CC1G_07742_Ccin  --DEVLIMEPLAGRPLSVPTRFVSSFEDLHLVLQQGCRGTLTSRYIECN--------E-Y
CC1G_06183_Ccin  --SNTLV--DESGRVVLSDF----------------GLSKVMEQVL---GP-------TG
                       :                               .

CC1G_11356_Ccin  ESTGLG------------------------------VGGTSRWQAPELFDPDNE------
CC1G_15178_Ccin  SRSSSL------------------------------FAGNELYCAPELLEEIIEGEAESV
CC1G_02847_Ccin  GDKYSR------------------------------HLQKVRWLAPEIIDPENVGPPD--
CC1G_04709_Ccin  RGFTTV------------------------------FTGACNYMAPELFQQGDTDA----
CC1G_06425_Ccin  RTSSTQ------------------------------GGGTIRWQAPELHDPNDD------
CC1G_00112_Ccin  FTQSSI------------------------------VADSFRYFAPEVCQGG--------
CC1G_04741_Ccin  GRGTSV------------------------------FAGSTRWMAPELIMALVED-DD--
CC1G_03393_Ccin  ASFTSH------------------------------LGGAVRWTDSCFFENLDEENKE--
CC1G_15177_Ccin  RSSTVA------------------------------TGGPYLFSAPELLVEDVQPAK-G-
CC1G_09415_Ccin  -ASGWT------------------------------PKGTARWKAPELLTGV--------
CC1G_02232_Ccin  ITGRQP------------------------------TRGTLRWQAPEILMGK--------
CC1G_01227_Ccin  -SMVRS------------------------------LVGTVNWQAPELWTA---------
CC1G_05652_Ccin  ---RID------------------------------GGRNPRYCAPEIFGSDEEEEPQWG
CC1G_13958_Ccin  ASATLT------------------------------AAGSARWLAPELIDGT--------
CC1G_13961_Ccin  QAMTVT------------------------------VASNPRWSAPEILRNAGSKS----
CC1G_07742_Ccin  QLDESSTNLILDSTCFQQLFKPGKQFESARSGSCLAQFNAVEYQYPSIPTPED-------
CC1G_06183_Ccin  FTTSTC------------------------------AGGTVRWLAPELLFDPRMEVD-P-
                                                           :  . .

CC1G_11356_Ccin  ---------SSRPTCYTDVYSLGCVFYEIFT-GNIPFHETT----REATVISYVMAG-KK
CC1G_15178_Ccin  SDAT-EDDQLGYKTLASDVYAFACICYEVYH-GKPRFFDLHGL-RRWKAIVGLI-D--DP
CC1G_02847_Ccin  -----ISTSLNDCTPSTDVYSFGMTILELFT-EKVPYHHVR----STPAVINEINN-RRH
CC1G_04709_Ccin  --------SEPTTTKASDVYAFSLVCVEVLS-GQRALPRFR----MEHQLMAFVVNG-GR
CC1G_06425_Ccin  --------VTPKATPESDVYSFACVCYEVMT-SRLPFYEFP----RDSTVIMKIMQG-HR
CC1G_00112_Ccin  ----------GKMSTMSDMYALGMTVLEILT-HQQPYRRVK----HHTEAVLKAA-RGIK
CC1G_04741_Ccin  -----NGGPGPKITPMSDVYAFGSVCLEIAT-DELPYSHRR----TDHAVTLDIIR-GIL
CC1G_03393_Ccin  -------WSAPPLTYKSDVYSLGCVMLEILS-GRPPYHYIALD----AQVVIELH-KGNK
CC1G_15177_Ccin  PGSH-EVTPAKKKSTQTDVYAFACVVYEMYT-GTPRFVNLA----LAEAYRAII-SN-EP
CC1G_09415_Ccin  ---------EGGLTPAIDVYAYAITCIEILSMGDIPWGSAED----SSLAYRVVVEH-LR
CC1G_02232_Ccin  ----------SELTREADVYAFAIACVEIINMGKLPWGSLLED----ETIRNMVVKEDSR
CC1G_01227_Ccin  ---------HPKYNHKVDVFSCAMVFWEMLQ-WHLPNKKFPWEGMNEHAIYEQVGAKKQR
CC1G_05652_Ccin  GGSEVDIWEAKPIASSSDVFAFGMVFLEVMA-GVPPYTYEYPPNRPYHELCFAVA-RGER
CC1G_13958_Ccin  ---------ISSPTFATDTYSFAMAVLELLT-GKYPFAERK----RDASVIHDVVVMKQT
CC1G_13961_Ccin  --------TVSPYSKKSDIWSIGMTFLELLT-GECPYAYES----IDVAVLRLIDNN-ET
CC1G_07742_Ccin  ------DDVG--------------------------------------------------
CC1G_06183_Ccin  YDDE-DIEAVETPTMASDIWSLGCVAYELAT-GKYPYADERY----DYNVMQAIMNKNRT


CC1G_11356_Ccin  PSRPVNNYILYRMEYGMREIIWSTIEKCWSRDVSTRPSLDRILSLEV-FQ----------
CC1G_15178_Ccin  THKP----------GGMSDLLWHWVECFWDRNPAARPSISAFVQAMCPTPLNNP------
CC1G_02847_Ccin  PGRLY--------CTEVPDELWCILESCWSHNAKERPTTAVLRSRIGALG----------
CC1G_04709_Ccin  PRRDKLEPL----PVEPTNWIWPILEACWQHNPYDRPTMKNIAEL---------------
CC1G_06425_Ccin  PSKPADSDLPW-FEADVIRELWRLVEECWQQNPSLRPGASDIVQRDI-IR----------
CC1G_00112_Ccin  PDQPREEEVK---ARGLDDDMWTLLLQCWSLTPEARPSIEEFIAR---------------
CC1G_04741_Ccin  PTRKDTCLV----KGVDEDRFWQLLERCWSLDVTLRPTMIEALHWLDGLR----------
CC1G_03393_Ccin  PRRPARS--------FVDDGQWELIQWCWTQPPEDRPDVRDVAEKLEELV----------
CC1G_15177_Ccin  CERP----------AAMPEPLWAWINRAWDLNPDRRPAMSEFIQEFDTGPPSIQ------
CC1G_09415_Ccin  PPVPED--F----R---HPHLEELLEQWWHKDPRARPEFKAIVSSLEAVG-HHIEAGALD
CC1G_02232_Ccin  PEIAEDS-------RFNTPALQVILKACWNRDPDRRPPFFEVSKDLKRIR-QTFENGDVM
CC1G_01227_Ccin  PSITG---L----RKQWCPEIVTLIEEMWAQDPSDRPTMSKVVETLED------------
CC1G_05652_Ccin  PRLERYA--------GLSNRQKGALQRMWEQDPSARPTMSQVVDMD--------------
CC1G_13958_Ccin  PARPQDPRV----CVWLTDELWNLLGGCWHNSAESRPTMAEVTGEL--------------
CC1G_13961_Ccin  PKRPREGKY----HHNITDHLWKLMTRCWKMKPDSRPDIAYVRGKLIRIR-EEA------
CC1G_07742_Ccin  ---------------------------------------------ITAEGQ---------
CC1G_06183_Ccin  PADVKE--E----WTGESRRVYRMLSRCWVREPSNRGNIREIVNLL--------------


CC1G_11356_Ccin  ------------------------------------------------------------
CC1G_15178_Ccin  -------------------YKYD----TA---------WDWTFLQDS-------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  -------------------YKWD----SK----PVSNLRSTTFLAVPPTP----------
CC1G_09415_Ccin  DVRRRMSQSAASLQSVEDVTLPDHSPRSADSASVLTSPFSPTMSVTPPDGGRSYFPVWVA
CC1G_02232_Ccin  DTPKG------SL-----TPLPEEQPPSSP------------------------------
CC1G_01227_Ccin  ------------------------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  -------------------YSPDAAQQST----QAASLFSPSFISTRVGTSR-HQRVATV
CC1G_07742_Ccin  ------------------------------------------------------------
CC1G_06183_Ccin  ------------------------------------------------------------


CC1G_11356_Ccin  ----------------------------------DAV-----------------------
CC1G_15178_Ccin  ------------------------------------------------------------
CC1G_02847_Ccin  ------------------------------------------------------------
CC1G_04709_Ccin  ------------------------------------------------------------
CC1G_06425_Ccin  ------------------------------------------------------------
CC1G_00112_Ccin  ------------------------------------------------------------
CC1G_04741_Ccin  ------------------------------------------------------------
CC1G_03393_Ccin  ------------------------------------------------------------
CC1G_15177_Ccin  -------------------------------------IRIQPPRL--GTSASSLSASTIT
CC1G_09415_Ccin  SNFNDMHLSPKSQNSGRLLDENSPTTMPTPMLPN-------------------------R
CC1G_02232_Ccin  ----------------------SPDMKP--------------LPLPPV-----------G
CC1G_01227_Ccin  ------------------------------------------------------------
CC1G_05652_Ccin  ------------------------------------------------------------
CC1G_13958_Ccin  ------------------------------------------------------------
CC1G_13961_Ccin  DNY-----SVVSSNSGN--DRNRPQDLPTLDVPQNGNLSHRPPSLRPSTSGSSNSGNSSN
CC1G_07742_Ccin  -------------------------