Protein (view, download) , Domain (view, download)
UTK01_Mbre      PQP---------------------------------------------------------
UTK02_Mbre      MATLEPDHT---------------------------YSC---LL----------------
UTK03_Mbre      MRASNAL-------------------------------L---------------------
UTK04_Mbre      MGHQARISA---------------------------ALT---L-----------------
UTK06_Mbre      TSRIAE------------------------------------------------------
UTK07_Mbre      MVYEVPKAA---------------------------S------R----------------
UTK08_Mbre      QLAV--------------------------------------------------------
UTK09_Mbre      MLQSPRKAG---------------------------A-----VE----------------
UTK10_Mbre      MPSLNAPRW---------------------------AHP---LL----------------
UTK11_Mbre      EQATITFTD---------------------------------------------------
UTK15_Mbre      MVAGGSVYS---------------------------V------Q----------------
UTK16_Mbre      MRLAGNRSA---------------------------VRPASQLR---SQ-----------
UTK17_Mbre      MVSAPAAGA---------------------------------L-----------------
UTK18_Mbre      MRRTCLGNEFTGGWACADDFNEMGIGTDLSEDFDSMAMV---FA----GVGVCFGVNNGH
UTK20_Mbre      MQAVRGWTG---------------------------A-----L-----------------
UTK21_Mbre      MAPSSARQR---------------------------G-----GE----------------
UTK22_Mbre      MTLHSEPTC---------------------------INA---FN---IH-----------
UTK05_Mbre      MVMHVRLPD---------------------------G-N---VRPCEF------------
UTK12_Mbre      MRAALAV------------------------------HA---VA----------------
UTK13_Mbre      MSQHFDL------------------------------AV---------------------
UTK19_Mbre      MIPASAHLL---------------------------VSN---LT----------------
UTK14_Mbre      MLLPLFA-V---------------------------V-----LL----------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------------GCLSLVLSAGASGLRAA---------------IVI-------G-
UTK03_Mbre      -------------------------------LS---------------FVV---AFIVV-
UTK04_Mbre      ----------------------------AVLLC---------------TLL---GHCAQ-
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      -----------------------LQRHSSRDSD--A------------STV---------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -----------------------PRLSGAVFLS----------------VL---AICLV-
UTK10_Mbre      -----------------------L------LL----------------------GLALI-
UTK11_Mbre      ------------------------------------------------------GHLPH-
UTK15_Mbre      -----------------------KQLTTAVFYG--V------------SSI---AIMMV-
UTK16_Mbre      ---------------------PG--AAGVLQNM------Y-----LVRAVL---VCCIV-
UTK17_Mbre      ----------------------------AVLV----------------------ALACI-
UTK18_Mbre      AAVEPGPVRSETESEGGHLLHPV--AAT-DLLSLNI------------SVV---CPILVR
UTK20_Mbre      ----------------------------ALVW-----------------AF---LQCSI-
UTK21_Mbre      -----------------------SRMPLVLL-------------------L---WAI---
UTK22_Mbre      ---------------------PV--EARVLELG--QCVTFVEDTTNSFAVFDSCSFVDG-
UTK05_Mbre      ------------KNEAGHQRYPR-----TALI----------------RLK---PRNLL-
UTK12_Mbre      -----------------------W-----VLL----------------------ALAT--
UTK13_Mbre      ---------------------PLEAAAAAFQLV---------------FVL---AAPVA-
UTK19_Mbre      ----------------EHAQSNLLQATWRVTLG--T------------DDN---AVTLV-
UTK14_Mbre      -----------------------AVAGSALLVG--A------------TVL---ATKLI-


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ------------------------RC---PR-----------------------------
UTK03_Mbre      PSR---------------------AG----------------------------------
UTK04_Mbre      ------------------------AC---TI------PAP--------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      SRVS--------------------------------------------------------
UTK10_Mbre      EPWA--------------------E-----------------------------------
UTK11_Mbre      IP----------------------SC------------APGYVGDGSFCEAQCNASIDQN
UTK15_Mbre      NKIV-----------LTQYGFPSA------------------------------------
UTK16_Mbre      IL----------------------TCA-----------STHVTADGVHFAA-SNEEEFDT
UTK17_Mbre      PWAQ--------------------GC---YEAGTKNQG----------------------
UTK18_Mbre      PTA---------------------SC---FA-----------------------------
UTK20_Mbre      PVDADSNDLDSNEIFL-CGFRPQKDC---EF-----------------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      IA----------------------NCSVGTV------PCDHWTKQSPTSCP-GDACTYDH
UTK05_Mbre      EFFT--------------------E-----------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------SC---TW-----------------------------
UTK19_Mbre      HR-------------------PYL--------------N---------------------
UTK14_Mbre      RRAR--------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------------------------------------D------------D------
UTK03_Mbre      -----------------------------------------------------K------
UTK04_Mbre      --------E------------------------------YT------------S------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      --------LGVAGTCLE-----------SIGPH--GLTWPA------------T------
UTK11_Mbre      SLGVAH------------------------------------------------------
UTK15_Mbre      --------EV-VAVCQM-----------VFTII--ALS-FA------------K------
UTK16_Mbre      YLSALEDVEA-ETTCTLDFHPNLAAIHILKADLTIACN-FQ------------LNTTNVT
UTK17_Mbre      ----CEDFNN-TRTCPRCCY--------------------GSFWLGRPRRFWPQ------
UTK18_Mbre      -----------------------------------------------------S------
UTK20_Mbre      --------DS-DARCQL-----------FEADL--CTR-FQ------------S------
UTK21_Mbre      --------IG-FGLC---------------------------------------------
UTK22_Mbre      ELGICHDKNA-KPVCSLYSAPNCGGA------------------------------SSSC
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ---------------------------------------WA------------I------
UTK19_Mbre      --------------------------------------TFN------------T------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      -----------H---SLPPLPK------------------KYAL----------------
UTK03_Mbre      ---------------------R------------------TLI-----------------
UTK04_Mbre      -----------N---------G------------------THLL----------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      -----------S---------S------------------G-------------------
UTK11_Mbre      IDR---------EK---------CFNARLEG-----------------------------
UTK15_Mbre      -------------------------------------------------LFGLVSY-PDF
UTK16_Mbre      LVQPHANSSLTLTGTRIWLQGVRLEAASIALLVSRHN-AQVVI-----------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      ---------------------P------------------NLL-----------NHDPDD
UTK20_Mbre      -----------N---------A------------------FE-EFGLQEIFALITQDEDD
UTK21_Mbre      ---------------------------------------------------------P--
UTK22_Mbre      YFEPLIN-----------------------MCIPRDACS---------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      -----------D---------N------------------VRLA----------------
UTK19_Mbre      -----------SSGHSHVAID---------------------------------------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ------------------------------------------------------------
UTK03_Mbre      -------------------------------------LQSPAVSTETNDTIAGSP-----
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      SGKVFWQVF-------------------------PLP------------------LIYLG
UTK16_Mbre      -------------------------------------KDSHISGTDVAIM----------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      RDD--------------------------------VSLRYAAADADA-HREQGLPLI---
UTK20_Mbre      LDVFSFRIFKNSDCTGDPFGFRVEQTDLRVDDCSPLS------------------LPFVG
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      -------------------------------------CSSTAISGETSVPVQGC------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      ----------VVSSLS---------KLLRVDGASHLALF-------LED-----------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----LIQVTLWLV--------------------------------VD-------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ----VTFNLTACL--------------------------------SDSHGHDL---LEHE
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ----------------------------------------------R-------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      NLI---------------------------------------------------------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      -----------M------------------------------------------------
UTK20_Mbre      N-QADFLFARACPICVKQAAGGNPEPAGFVT--------------ND-------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ----QLQRMLACS--------------------------------LD-------------
UTK19_Mbre      -SNTGTGVAEAVSLVVTYR-----QPLGFEPASVKAALQSQRPASFTAAPQDNSLST-AY
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ---------------TTNIPHPVWTT---------------PLFI---------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      HF-HLTLQPT-----VNT------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ---------------ATT------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ---------------------------SGL------------------------GGTQLI
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      -----NFTPRIQTHAHTH------------------------------------------
UTK18_Mbre      -----TLDPT-------T------------------------------------------
UTK20_Mbre      ---------------NVTA--FHWPRRSGLYFTGNQNSDPCPLLNGGNMVDFDVDGVIL-
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      -------DPA--------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ---------------TTT------------------------------------------
UTK19_Mbre      IFYSNNTTPR-----TYT-----AYAVPNA------------------------G-----
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      --P--R------------------------KQPASDANPLPALIHHPTP-----------
UTK03_Mbre      ------------------------------------------LI----------------
UTK04_Mbre      ------------------------------------------LYGLPPT-----------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ---------------------------------------------LP-------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      SLPMFTLLRRFSILMTMLAEKWMLGDD---------------------------------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      ------------------------------------------TLEFPKMPGSSRLIGYTF
UTK18_Mbre      ------------------------------------------QI----------------
UTK20_Mbre      --P--AD-------------------MPPYVWSRSNSW---SLLHTPPG-----------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ---------------------------------------------VP-------------
UTK13_Mbre      ------------------------------------------LLPLPSP-----------
UTK19_Mbre      ALHTLRLLRRTTSC----------------------------------------------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ---TPRSISS---RVFHPGC----------------------------------------
UTK03_Mbre      ----A-------------------------------------------------------
UTK04_Mbre      -ATIPSVSGLA--RT---------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      -CPSP-------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      -----LSFNL---VGY---MYILVNDLLTAVNGVVIKKKLDSKELGSFGL----MYYNCL
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      SLSI--------------------------------------------------------
UTK18_Mbre      ----PRITGLEGAA----------------------------------------------
UTK20_Mbre      ---VPATVLR---NVY---C----------------------------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      -CL---------------------------------------------------------
UTK13_Mbre      -CPQPGIIGL---KT---------------------------------------------
UTK19_Mbre      --------------------STVDLDMCPHIS--------------SCGLFLGRSLCRQ-
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      -----------LAHSVIACWSLTGPHLGERHRHLVPHPDSARWLLLSLPYRPSW------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      -------------------------HTGS-------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      FSLPFAVATVFL--------------------------------------EP--------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      -----------L--------------------------------------RPSVLNSARR
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      VRLPKACY----------------------------------------------------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------ARD-------------Q--------NS---LSA----------------L
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      -------------------LEDV---------------TIIA------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -------PAGAADASIYTDLMDLNIVN--------WRC---LT----------------I
UTK10_Mbre      --------------------------ASRSCCASAQQATTLCL----------------L
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      ------------------------------------------V----------------M
UTK17_Mbre      -------PRHNLE-----------------------------I----------------A
UTK18_Mbre      -------PFHFVQASIN------------------------SS----------------L
UTK20_Mbre      RRDEIVDPTETIKTT----AAVLRLTS--------QRS---LT----------------L
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------T----------------V
UTK05_Mbre      ------------------------------------------AATFLQKQLHNQFMSEDI
UTK12_Mbre      --------------------------------ITAQRTVRI-------------------
UTK13_Mbre      -----------LD-------------N--------VTT--ITT----------------V
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      -------LRHSRD-------------N--------ERP---ET----------------V


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ASS---AG-----A---LVAMV--------------AP--LR------------------
UTK03_Mbre      -------------------TVP--------------NN--A-L-----------------
UTK04_Mbre      -------L-----L---LATNV--------------SS--PVSRSQMNHT----------
UTK06_Mbre      ------------------LIQE--------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      G-----------------------------------------------------------
UTK10_Mbre      QAWSEPSY-----A---QCAIP--------------SLEGWSSDW-ATGA----------
UTK11_Mbre      -------------------------------------------------L----------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      AQN---SI--VA------L--Y--------------NSA----------L----------
UTK17_Mbre      VAA---NY-----A---ILFDP--------------QL--VLSAE-VQAL----------
UTK18_Mbre      DNA----I-----P---ISCSP--------------ND--V-LG----------------
UTK20_Mbre      DI----SD-----M---VCATP--------------ST--Y-ID-----Y----------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      GTS---ETDFPGQA---GCYIA--------------GGA---------------------
UTK05_Mbre      SATPFLKLNLCILNMISFLIEEFHNMKKRCSQTPMEE------------ALQHIKDNCGG
UTK12_Mbre      -------------G---FVATR--------------SYFGHH----NAGG----------
UTK13_Mbre      STS---ST-----A---AITTT--------------SS--ETSAA-PTAL----------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      TAT---ET-----S---VIAVP--------------NE--M-MVA--SAL----------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------------------------------------------------LS-ASSLL
UTK03_Mbre      -----------------------------------------------------N-TFATL
UTK04_Mbre      ---------------------------V-----T--F----------AA---AY-CTATF
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ----------------------------------SST----------TG-----------
UTK10_Mbre      PTSAAAR--------RQRLAG-----AA-----TIVA----------SSALPLG-STDVT
UTK11_Mbre      LLQYPEYASTLD-------------E----------------------------------
UTK15_Mbre      ---------------------------S-----KLEA----------TR-----------
UTK16_Mbre      FASDAALSLATN-------------GTL-----T------------------VE-HTSIA
UTK17_Mbre      ---------------------------GTLPTWA------------------IN-DGTFL
UTK18_Mbre      ---------------------------------PADGSARKTAPTHFSASPAWN-VLSTL
UTK20_Mbre      ---------------------------S-----TTQG----------AG-----------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ---EWADAC-GCVTNSSRYPGAAFRPCL-----Q------------------VD-CTTI-
UTK05_Mbre      Y-EAFMM--------QTVIDE-----YS-----TEQLAIEIENRIRSKKLWPRREGIVIT
UTK12_Mbre      FQTEFAY--------RAALDY-----FS-----TVDP----------S-----------V
UTK13_Mbre      ---------------------------T-----T--N----------GA---AS-STSAV
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      ---------------------------S-----T--D----------HG-----------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      LFL---------------SLAP------A-VALALN----------INR-ADLILSDVG-
UTK03_Mbre      A-----------------------------------------------------------
UTK04_Mbre      SFY---------------CLAPQQYYSWFL-TV-------DD--------DEILVT----
UTK06_Mbre      ----------------------------------------E-------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ----------------------------C-FETDDD----------RLV-AINL--KTS-
UTK10_Mbre      EIL---------------R--------------LVQR---ASTAIDASAAANLTIADLET
UTK11_Mbre      ------DLLWGTY-----------------------------------------------
UTK15_Mbre      ----------------------------A-FEFWHDP---------SFM-ACFL-AS-C-
UTK16_Mbre      SMLGIVSPFGAARSLEIIH-----------------SHITACLAIRGA------------
UTK17_Mbre      G-----------------------------------------------------------
UTK18_Mbre      Q-----------------------------------------------------------
UTK20_Mbre      ----------------------------S-FSTSLD----------ADT-ATLTVSSAS-
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ---IPVQPTGAYQP----------------------------------------------
UTK05_Mbre      EYL---------------R--------------IVQE---Y-------------------
UTK12_Mbre      QFE---------------T--------------IYQE---SSTTVNKSAA----------
UTK13_Mbre      SLF---------------SI-----------------------------------YKAA-
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      ----------------------------CTRETLEA----------------------R-


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      -PCE-------------LTLQFDGSVSA---------------TDVH-------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      --------SPADIQIP-EALEFDGDIYVQELTSTSANLIVHAHTDVA-------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -LSFYGITSPV--FVP--------------------------------------------
UTK10_Mbre      HLDLFD-----------ALLQADWKIPD---------------PDAG-------------
UTK11_Mbre      --CP-------------MTCELDPSVTL---------------VDVYCN-HE--------
UTK15_Mbre      -AMGFLLTYSI--FICTQVNSALTTTV---------------------------------
UTK16_Mbre      --AN-------------HLLLADSSVSL---------------ADSALDCHTAGLIYLDK
UTK17_Mbre      ---YTNATIPTGTAAVI-------------------------------------------
UTK18_Mbre      -----------ATQVPL-------------------------------------------
UTK20_Mbre      -STIIWLRFTA--FCPG-------------------------------------------
UTK21_Mbre      -----------------LTNSQSSST----------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      -WCQ-------------AIFQDDPTVQS----------------DIF-------------
UTK19_Mbre      -----ALRSEA--A----------------------------------------------
UTK14_Mbre      -DSFARIEIPDASELPL-------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ---LEQMILTEGWYAPPQTVVTSGPRRVDAQTLSANLDCVSHAL----------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ---MTA------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -------------------------------------------------ET---------
UTK10_Mbre      ---S----------------------------------------------T---------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------VGCLKNILVAYLGMT---------
UTK16_Mbre      PART----------------------------------------------VNVSRNEIEL
UTK17_Mbre      ----------------------------------------------GTLSS---------
UTK18_Mbre      ----------------------------------------------PSLLV---------
UTK20_Mbre      ----------------------------------------------VFAHA---------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      --------------------------------------------------I---------
UTK13_Mbre      ---HREE------------------------------------V----------------
UTK19_Mbre      -----------------------------------------------CADT---------
UTK14_Mbre      ----------------------------------------------GSLSA---------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      --------------------------------------------NP--------------
UTK03_Mbre      ----------------------------------------AFRFNT--------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ---------------------------------------FVA------------------
UTK07_Mbre      -----------------------------------SADHVYDMIDD--------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -----------------------------------EADHVYFGLNG--------------
UTK10_Mbre      -----------------------------------QMAQVYVQL----------------
UTK11_Mbre      -------------------------------------GTWVS------------------
UTK15_Mbre      -----------------------------------MADYVFSWLNF--------------
UTK16_Mbre      GNASAVTRVVGVIHLLDATNVSVYNNTFLATPQSTQLDYWVFILNGTRAVVAQNTFNGGG
UTK17_Mbre      -----------------------------------EGKYVYFGTFS--------------
UTK18_Mbre      ----------------------------------------ADLPRM--------------
UTK20_Mbre      -----------------------------------AATYVQGGQYN--------------
UTK21_Mbre      -----------------------------------TV-----------------------
UTK22_Mbre      ------------------------TANILAPPQSAS------------------------
UTK05_Mbre      ---------------------------------------AMFGKAD--------------
UTK12_Mbre      -----------------------------------RCTETA-------------------
UTK13_Mbre      --------------------------------------------NG--------------
UTK19_Mbre      -----------------------------------AACYWHDGLGA--------------
UTK14_Mbre      -----------------------------------KAKAGRFSIQD--------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------ASH-----------------------------------------------
UTK03_Mbre      ----------FDLS-RQAI-----------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ----------QNV-----------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ----------AGL--AQAL---------ASHSVETL----------------TVAI----
UTK10_Mbre      ---------------AHA------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ----------AGI--NLRL---------SQLVSLTT----------------T----TLL
UTK16_Mbre      GLIYTQFLSHV-------------------------------------------------
UTK17_Mbre      ----------GWV--GKSTLVHIFPQEGSIHIDLTTTGLFQAARELGVQVFDS-------
UTK18_Mbre      ----------ADALLHLHS-----------------------------------------
UTK20_Mbre      ----------SII--AHDT---------LAVALETL----------------AANH----
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ----------SYA--RAETIVSL---------I---------------------------
UTK12_Mbre      ----------------QA------------------------------------------
UTK13_Mbre      ----------ISL-----------------------------------------------
UTK19_Mbre      ----------CW---GHD------------------------------------------
UTK14_Mbre      ----------AFL--QQDG---------QKHNPLYD----------------SISSRSGA


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ------------------------------------------------------------
UTK03_Mbre      --------------------------------------------------------I---
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      -----------LFLAPNTALASPEPWAWHAAAVQAALLMGPAPELMTTGDHFVLSWA---
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      FENTKTFSLSKF--------------------------------------------L---
UTK16_Mbre      ------MVEDN-------------------------------------------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      --------------------------------------------------------KTRL
UTK20_Mbre      ------------------------------------------------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      -----------L--------------------------------------------V---
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      -------------------------------------------GLCTSGSECASQM----
UTK14_Mbre      A-----------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      -------------------------------------------------------SYTLS
UTK03_Mbre      --------------SHA----AFEL-----------------------------------
UTK04_Mbre      -------------------------------------------------------EVLVW
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      --------------------------LP--------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      --------------PNA----TLAI-----------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      --------------SLS----IYLFFFPSKCSCLISVVFLCMKAAIAASQDAESF----A
UTK16_Mbre      ----------------FASLQVHWRIYTHGCLMIDSR-----------------------
UTK17_Mbre      ---------------E--------------------------------------------
UTK18_Mbre      PLLLIQLEPSVFRRTHY----LFTL-----------------------------------
UTK20_Mbre      ------------------------------------------------------------
UTK21_Mbre      ------------------------------------------------TQTTPSV----A
UTK22_Mbre      ------------------------------------E-----------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      --------------AND----VHLV-----------------------------------
UTK13_Mbre      -------------------------------------------------------GRTVP
UTK19_Mbre      --------------------------------------------CPLATLSDDTV----R
UTK14_Mbre      ---------------------------------------------------TAAVMRELM


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ----------------------------------------------FSPALH-ADLP-A-
UTK03_Mbre      ------------------------------------------------------A-----
UTK04_Mbre      ----------------------------------------------FSQAGN-SLSP-Y-
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      -----------------------------------------------S--------PNP-
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -------------------------------------------QAASQ--------P-P-
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      GST----------------------------------------TTAME--------PNP-
UTK16_Mbre      ----------------------------------------------------VLLLT--R
UTK17_Mbre      ----------SDSNLVQLQACQMVLHNQGTDLFITTLWGG--------------------
UTK18_Mbre      ------------------------------------------------------LND---
UTK20_Mbre      -------------------------------------------PLASTPVLYAAAFP-A-
UTK21_Mbre      QST----------------------------------------VAPRT--------PKP-
UTK22_Mbre      ----------------------------------------------------FLIPY--R
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ----------------------------------------------FGSAGC-PSLP-A-
UTK19_Mbre      AATVLRLPTTN------------------RSMFLSSSTSGTGFIKVAA--------PSPT
UTK14_Mbre      ESE-------N------------------G-------------PQARS--------P-G-


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      --G----------------NSTLIVNLTRTAEAPLRLPANICTRLVTEGPATKDITITTL
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      --N----------------SV---------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      -IS---------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      --E----------------TLP--------------------------------------
UTK10_Mbre      -------------------------DNAK-------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      -LA---------------------------------------------------------
UTK16_Mbre      NIL---------------------------------------------------------
UTK17_Mbre      --VQLLPFGLAPMALTILNTT-PVVNGSA-------------------------------
UTK18_Mbre      ----------------------------------------R-------------------
UTK20_Mbre      --G----------------TNT--------------------------------------
UTK21_Mbre      --S---------------------------------------------------------
UTK22_Mbre      LIS---------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      --N----------------PTS--------------------------------------
UTK19_Mbre      TA------------------------GL--------------------------------
UTK14_Mbre      --R----------------S-T--------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      AQAQDMARRRCTG-FFGALTFRNLTL----------------------------------
UTK03_Mbre      ------------------------------------APAN--------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -----------N------------------------------------------------
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      -------------------------TID--VMVGHHGP----------------------
UTK18_Mbre      ------------------------------------CTDV--------------------
UTK20_Mbre      -----------MG--------------------YH-PQAESLELSASVGCDLSFDFPTWV
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      -----------LQTVFAGLS--FSCTPETTFSLGD-------------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      -----------LGGTVHALVRRNSCESD--ITAGE-SPHNQESLSP--------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ------------------------------------------------------------
UTK03_Mbre      ------------------------TGSLGNC---------------SIRIAFA---TANA
UTK04_Mbre      -------------------------------------------------------QMSYG
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      -DL-----------------DPVISSPL---ALVESSPGTS----P--------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -----------------------GV---SDC---------------SLVTDLRVGQVDYD
UTK10_Mbre      -TF-----------------DMTVLTQW---TLAATENGTT----PT-----PSS--TTS
UTK11_Mbre      ------------------DIE-------------QQCPR-Y----P----------NATC
UTK15_Mbre      ----------------------------------TVGGGTK----PAGWTDLEMAQARS-
UTK16_Mbre      -DLVTGSRGVYATCSQCLAVD-------------NTIN--F----A----------LANG
UTK17_Mbre      ---------------------------KTSDPVPQILKRSYASRWRITFNNSGPIVFNLD
UTK18_Mbre      ------------------------LGPAATC---------------DIRMFVP---TSQH
UTK20_Mbre      GLP-----------------SDTAF---ASC---------------ALSTLAATL--TTS
UTK21_Mbre      -PL-----------------LPTVTTTQGNASLLPA----F----A--------------
UTK22_Mbre      -DI-----------------HPVGCRPI---GYWISSQ--F----A----------ATNG
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ---------------------------------------IG----PS-------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      ---------------------------------MNEYPLIA----P--------------
UTK14_Mbre      -----------------------------------------------LRQA---LANNYD


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ------------------------------------------------------------
UTK03_Mbre      STVLTTADRDLTARG---------------------------------------------
UTK04_Mbre      AVVNS-------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      -----------------GASP-SVDRKLR-------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      -LVL-SCSLDHTAGNQETGYIAVILWSPDSSSLTVTDFV----------VVEPRCGTVLQ
UTK10_Mbre      -KAL-TEESMQLALCLAAYLPASNPNGRHHI-----------------------------
UTK11_Mbre      PA-VNA------------------------------------------------------
UTK15_Mbre      ------VTPLSKAGAQSNGHS-TLSRTDRPAAIDLSNMTMTRPKQRYVNLAEPGPGSLAD
UTK16_Mbre      SSIPNT------------------------------------------------------
UTK17_Mbre      HLIWRTPAS---SSRVEAFIPSSLPGTHQYYAI---------------------------
UTK18_Mbre      PKILTSDPRWPTRQG---------------------------------------------
UTK20_Mbre      -AML-T------------------SSSPVAYPLAVAADA----------G------PRLE
UTK21_Mbre      -----------------GDDP-SFWEEYR-WYLIA-----------------AAAGLVVF
UTK22_Mbre      FSIMDM------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ---------------PCVHACQ--------------------------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      RMVMTSASSPQSASGSGPGYSTLL-DVNANGDTKRHSYAEADELAGTDTVP------PL-


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ---------------------------------------------------SPADWRA-L
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ----------NIFSRL--RRR-DNS----RL-----------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      GE----------------------LRL---------------------------------
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      PQSRPAPVPQDSFE-M--THR-SPS----NL-----------------------------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      QD----------------------LRPVVTASGAALLSSRHYTLCHSSFALSLVEWRAAP
UTK21_Mbre      VVAAFLLRRLCCRGRC--CRR-SHKR--TTL-----------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ----------NTYAEIHAGRRIL-------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ---------------------------------------------------L--------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      -------------------------------QRAHSYAEADELA-------------ADN


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      LMPLRLVEGSLRFEATPGL--QVEALGGLQWLAARGPYHQDERGTYGLRINNVPGFVVTD
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      --------PVTFAGMTPVDPAC--------------------------------------
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      --------------------------ARLA-VLGFGQSTDD-------------------
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      FDAEQLCAPLVLDLCLPGDSRVVRALGGYTQAVTNVTYI---------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      --------------------------SETV-KTKRGD-----------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      -------------------------------VAGSGEASDD-------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      DGY---------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      GLRLLSL-------------------------------R---------------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ------------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      ----EPGHGLCQNNHIIASFRLQHAIDIRQSHANWTVVDNTAMTIVDNVPNVVEHYGIYF
UTK17_Mbre      ------------------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      --RLTQG-------------------------------S---------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      ------------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      ---------TGQ-RIVVIGSEAAQCPPADNEALQAWILSAPLVDLRYN------------
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      -----------------------------------------------SIH----------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      ------------------------FPTVLFDANQPGGLTAGPVDVQY-------------
UTK11_Mbre      -----TRLA---------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      EGGALHSLRNT-FSYYGLGIVVVQCNTAVFESN--------------------IVLGSFV
UTK17_Mbre      ----------------------------NF---------------ENRFFSMNPANGAFA
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      ---------TGTHRVLLYHASYCR---------------SGPADVELQFAPQLPAINASG
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      ---------------------------------------------------------IYD
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ----------------------------------YFPNA---------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      ----------------------------------------------ERADDLGAASGPAP


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      -VSACVDTSEDSNCAGAVDELTGLCRHSVTDKSVCPGGIITSLADLAPYSDYLCTVIDGS
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      NVA---------------------------------------------------------
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ------------------------------------------------------------
UTK16_Mbre      AVWLDFAALHAVLGGATDPRTQANWLEASNTGIRAGGANATLYDNTLAGNPDTVLRVDGA
UTK17_Mbre      LLA---------------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      SVAG--------------------------------------------------------
UTK21_Mbre      ------------------------------------------------------------
UTK22_Mbre      AIWSQYQPSIAVFQ--------------------RGGGMRRIQHNTS-------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      LLRS--------------------------------------------------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      LKI--------------------------------------------------LGPLEFA
UTK03_Mbre      ------------------------------------------------------------
UTK04_Mbre      ----------------SLNT----------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ----------------------------QDHTS-NAAS----------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      -SL--------------------------------------------------WGPLQRQ
UTK11_Mbre      ------------------------------------------------------------
UTK15_Mbre      ----------------------------TDLTTSSEAS----------------------
UTK16_Mbre      ------------------------------------------------------------
UTK17_Mbre      -SHDFPSGRNL-------------------------------------------------
UTK18_Mbre      ------------------------------------------------------------
UTK20_Mbre      --AWFLTQRRL-------------------------------PAQDLVGEGLDVGQ----
UTK21_Mbre      ----------------------------KGFDTSPDAA----------------------
UTK22_Mbre      ------------------------------------------------------------
UTK05_Mbre      ------------------------------------------------------------
UTK12_Mbre      ------------------------------------------------------------
UTK13_Mbre      ------------------------------------------------------------
UTK19_Mbre      ------------------------------------------------------------
UTK14_Mbre      --HSYAEADELAAPDDDGYDKAQDIMGGSDHHSYA--EADDLA-----------------


UTK01_Mbre      ------------------------------------------------------------
UTK02_Mbre      EH---------------------ELGVLARVEHVLGGV----------------------
UTK03_Mbre      ------------------------------------TE----------------------
UTK04_Mbre      ------------------------------------------------------------
UTK06_Mbre      ------------------------------------------------------------
UTK07_Mbre      ------------------------------------------------------------
UTK08_Mbre      ------------------------------------------------------------
UTK09_Mbre      ------------------------------------------------------------
UTK10_Mbre      DQ---------------------AHQA------LLRLI----------------------
UTK11_Mbre      -------------