Protein (view, download) , Domain (view, download)
HSER_Hsap_RGC      MKTLLLD----------L------------------------------------------
CG10738_Dmel_RGC   MFAHPCPAPAGNYHSGLL--H---------------------------------------
CG9783_Dmel_RGC    MLCCWLQ-----------------------------------------------------
Gyc32E_Dmel_RGC    MRDYASNVI-RSHRCLCI--F---------------------------------------
Gyc76C_Dmel_RGC    MTRWPF------------------------------------------------------
CG4224_Dmel_RGC    MLLV--------------------------------------------------------
CG3216_Dmel_RGC    MHLL--------------------------------------------------------
KSGC_Mmus_RGC      MASRTRS----------E--S--------------------------------------P
HSER_Mmus_RGC      MTSLLGL-----------------------------------------------------
CYGX_Mmus_RGC      MAGLQQG----------CH-F-------------EGQNWTA-PHWKTCLPCQ-GPWRLTV
CYGF_Mmus_RGC      MFLGPWP----------FSRL-------------L--SWFAI-----------------S
CYGD_Mmus_RGC      MSAWLLP----------AGG---------------------LPGAGFCVPARQSPSS--F
ANPb_Mmus_RGC      MALP--------------------------------------------------------
ANPa_Mmus_RGC      MPGSRRV----------R--P---------------------------------------
odr-1_Cele_RGC     MCVLRLW----------Q--M---------------------------------------
gcy-9_Cele_RGC     MGPSGMI----------R--S---------------------------------------
gcy-8_Cele_RGC     MRTKKAF----------L--L---------------------------------------
gcy-7_Cele_RGC     MKPFYSM-----------------------------------------------------
gcy-6_Cele_RGC     MRSAEPR-----------------------------------------------------
gcy-5_Cele_RGC     MRLLYFS-----------------------------------------------------
gcy-4_Cele_RGC     MILFSKY-----------------------------------------------------
gcy-3_Cele_RGC     MKNVFQL-----------------------------------------------------
gcy-27_Cele_RGC    MNKLITV-----------------------------------------------------
gcy-25_Cele_RGC    MLLLLL------------------------------------------------------
gcy-23_Cele_RGC    MPNAGFW----------S--A---------------------------------------
gcy-22_Cele_RGC    MSFISKC-----------------------------------------------------
gcy-21_Cele_RGC    MLSAVLL----------L--L---------------------------------------
gcy-20_Cele_RGC    MRILLL------------------------------------------------------
gcy-2_Cele_RGC     MVSSILK-----------------------------------------------------
gcy-19_Cele_RGC    MEYLLFL-----------------------------------------------------
gcy-18_Cele_RGC    MLKTLLF----------I--L---------------------------------------
gcy-17_Cele_RGC    MINRNK------------------------------------------------------
gcy-15_Cele_RGC    MGLMRDC----------Y--I---------------------------------------
gcy-14_Cele_RGC    MCLFLL------------------------------------------------------
gcy-13_Cele_RGC    MASS--------------------------------------------------------
gcy-12_Cele_RGC    MWPTSVE----------A--LRFYHTFAFSPGRRR-------------------------
gcy-11_Cele_RGC    MLDIMLA----------D--TKK-------------------------------------
gcy-1_Cele_RGC     MQIFTIL-----------------------------------------------------
daf-11_Cele_RGC    MGP---------------------------------------------------------
C04H5.4_Cele_RGC   MLPNFWN----------F--Q---------------------------------------
CYGF_Hsap_RGC      MFLGLGR----------FSRL-------------V--LWFAA-----------------F
ANPb_Hsap_RGC      MALP--------------------------------------------------------
ANPa_Hsap_RGC      MPGPRRP-------AGSR--L---------------------------------------
CYGD_Hsap_RGC      MTACARR----------AGG---------------------LPDPGLCGPAWWAPS---L
T01A4.1_Cele_RGC   MIDR--------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      MEKM--------------------------------------------------------
Gcy3_Spur_RGC      MLGGSA------------------------------------------------------
Npr3_Spur_RGC      MTAI--------------------------------------------------------
Npr4_Spur_RGC      MAEDAPN----------D--D---------------------------------------
Gcy1_Spur_RGC      MAHARH------------------------------------------------------
Gcy2_Spur_RGC      MFQYYK------------------------------------------------------
Npr5_Spur_RGC      MSNAMS------------------------------------------------------
AqueK220_Aque_RGC  MADSKSL-----------------------------------------------------
AqueK221_Aque_RGC  MIFTLL------------------------------------------------------
AqueK222_Aque_RGC  MFSSGL------------------------------------------------------


HSER_Hsap_RGC      ---------------AL------------WS-LLF-QP----------------------
CG10738_Dmel_RGC   -------------PLLL------------LL-FLL-AF----------------------
CG9783_Dmel_RGC    ---------------------------------QL-------------------------
Gyc32E_Dmel_RGC    -------------TVLQ------------LT-LML-SM----------------------
Gyc76C_Dmel_RGC    --------------NL--------------L-LLL-SV----------------------
CG4224_Dmel_RGC    -----------------------------LL--LV-GL----------------------
CG3216_Dmel_RGC    ---------------GI------------SI-HFF-FL----------------------
KSGC_Mmus_RGC      LEPRLYAGAGSRADHPS------------LV-LML-SV----------------------
HSER_Mmus_RGC      ---------------AV------------RL-LLF-QP----------------------
CYGX_Mmus_RGC      SHLKT---VSSISVLSV------------VFWSVL-LW----------------------
CYGF_Mmus_RGC      SRLSGQHGLPSSKFLRC------------LC--LL-AL----------------------
CYGD_Mmus_RGC      SRVLR---WPRP-GLPG------------LL--LL-LL----------------------
ANPb_Mmus_RGC      ---------------SL------------LL--VV-AA----------------------
ANPa_Mmus_RGC      -------------RLRA------------LL--LL-PP----------------------
odr-1_Cele_RGC     --------------RRPMDSVQQSQYSEKHL-ELL-TV----------------------
gcy-9_Cele_RGC     --------------EWLH----------KTS-HLL-RR----------------------
gcy-8_Cele_RGC     --------------L------------------TF-NV----------------------
gcy-7_Cele_RGC     ---------------SL------------VL--FL-VI----------------------
gcy-6_Cele_RGC     ---------------NE------------KC--IL-NTSDASQTIQDCPLIHFHNSFPVN
gcy-5_Cele_RGC     ---------------MV------------LL---W--V----------------------
gcy-4_Cele_RGC     ---------------YF------------SM-RQLNYY----------------------
gcy-3_Cele_RGC     ---------------LI------------PL---F-FH----------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ---------------------------------LL-KI----------------------
gcy-23_Cele_RGC    --------------A------------------YA-EM----------------------
gcy-22_Cele_RGC    ---------------FI------------CL--LF-ST----------------------
gcy-21_Cele_RGC    ----------------------------------F-FI----------------------
gcy-20_Cele_RGC    ---------------------------------LL-QN----------------------
gcy-2_Cele_RGC     ---------------FV------------IL---I-HS----------------------
gcy-19_Cele_RGC    ---------------L-------------LF---AGFL----------------------
gcy-18_Cele_RGC    --------------I------------------FF-NI----------------------
gcy-17_Cele_RGC    ---------------------------------IL-------------------------
gcy-15_Cele_RGC    ----------------------------------Q-ST----------------------
gcy-14_Cele_RGC    ---------------------------------LF-P-----------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    -------------RLFG------------LS-IVF-VI----------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     -----------------------------LL---F--N----------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   --------------F------------------IF-VI----------------------
CYGF_Hsap_RGC      RKLLGHHGLASAKFLWC------------LC--LL-SV----------------------
ANPb_Hsap_RGC      ---------------SL------------LL--LV-AA----------------------
ANPa_Hsap_RGC      -------------RLLL------------LL--LL-PP----------------------
CYGD_Hsap_RGC      PRLPR----ALP-RLPL------------LL--LL-LL----------------------
T01A4.1_Cele_RGC   ---------------KL------------SI---F-T-----------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ---------------LI------------FT-SLF-SV----------------------
Gcy3_Spur_RGC      ----------------P------------L------KA----------------------
Npr3_Spur_RGC      ---------------LL------------AL--LL-TG----------------------
Npr4_Spur_RGC      ---------------------------------MI-PS----------------------
Gcy1_Spur_RGC      --------------LFL------------LL-VAF-TI----------------------
Gcy2_Spur_RGC      ----------------L-------------------------------------------
Npr5_Spur_RGC      --------------KQS------------LL-----------------------------
AqueK220_Aque_RGC  ---------------PF------------SL--FF-AA----------------------
AqueK221_Aque_RGC  ---------------NL------------LL--FF-SA----------------------
AqueK222_Aque_RGC  --------------CY--------------H-QIG-DN----------------------


HSER_Hsap_RGC      ----------G-W-L-----S----F------S-S--Q----------------------
CG10738_Dmel_RGC   ----------S-N------------F---R------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ----------L-E-V-----Q----I---Q--I-D--Q----------------------
Gyc76C_Dmel_RGC    ----------A-V-R-----D---------------------------------------
CG4224_Dmel_RGC    ------------V-F-----G----PKDCV------------------------------
CG3216_Dmel_RGC    ----------M-Y-V-----N----C---F----S--A----------------------
KSGC_Mmus_RGC      ----------V-M-L-----V----T---C--L-E-------------------------
HSER_Mmus_RGC      ----------A-L-M-----V----F---W--A-S--Q----------------------
CYGX_Mmus_RGC      ------------A-D-----S--------L----S--L----------------------
CYGF_Mmus_RGC      ------------L-P-----L--------L------------------------------
CYGD_Mmus_RGC      ------------L-P-----S--------P------------------------------
ANPb_Mmus_RGC      ------------L-A-----G----G---V------------------------------
ANPa_Mmus_RGC      ------------L-L-----L--------L------------------------------
odr-1_Cele_RGC     ----------I-I-L-----LKLFG-------V--------------FH-----------
gcy-9_Cele_RGC     ----------F-I-NPTTPNFLHFTST--YIGI-R--S------INTFL-----------
gcy-8_Cele_RGC     ----------L-I-Y-----L----AA-----C-Q--E------TERIL-----------
gcy-7_Cele_RGC     ----------T-L-L-----P----KP----------M--------------------F-
gcy-6_Cele_RGC     DRSLSTFCNFSFI-I-----C----DP----------G----------TRNFKLASVRFL
gcy-5_Cele_RGC     ----------L-G------------AS--E------------------------------
gcy-4_Cele_RGC     ----------I-F-I-----S----TI--L--T-Y--N--------------------L-
gcy-3_Cele_RGC     ----------L-F-------S----LV--S--L-Q--N--------------------I-
gcy-27_Cele_RGC    --------------------IRDFS-----------------------------------
gcy-25_Cele_RGC    ----------S-T-F-----V---------------------------------------
gcy-23_Cele_RGC    ----------P-ISK-----F----TA-----Y-A--E-------NAVM-----------
gcy-22_Cele_RGC    ----------Y-F-L-----P---------------------------------------
gcy-21_Cele_RGC    ----------Q-N-V-----Q--------N--F-D--K----------------------
gcy-20_Cele_RGC    ----------I-L-V-----F---------------------------------------
gcy-2_Cele_RGC     ----------T-F-------H----ST--F--A-Q--N--------------------L-
gcy-19_Cele_RGC    ----------T-F-L-----P----RF--L--IYA--Q--------------------I-
gcy-18_Cele_RGC    ----------P-I-------I----A------I-E--E------IPDI------------
gcy-17_Cele_RGC    --------------A-----N---------------------------------------
gcy-15_Cele_RGC    --------------I-----L---------------------------------------
gcy-14_Cele_RGC    ----------Y-L-A-----S---------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ----------A-A-L-----C----VT--S--C-D--A----------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ----------I-F-------P----SI--F--V-Q--N--------------------L-
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ----------F-C-W-----I----PI-----V-V--S------D---------------
CYGF_Hsap_RGC      ------------M-S-----L--------P------------------------------
ANPb_Hsap_RGC      ------------L-A-----G----G---V------------------------------
ANPa_Hsap_RGC      ------------L-L-----L----L---L------------------------------
CYGD_Hsap_RGC      ------------L-Q--------------P------------------------------
T01A4.1_Cele_RGC   ----------R--------------K---K----S--T----------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ----------I-I-I-----V----L---I----S--G----------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ----------P------------------P----H--N----------------------
Npr4_Spur_RGC      ----------H---T-------------------D-------------------------
Gcy1_Spur_RGC      ----------T-M-V-----I----A---R--L-D--F----------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ----------F-F-I-----A----AV--Q--A-RTYRIPSYLTC---------------
AqueK221_Aque_RGC  ----------C-K-A-----A---------------CTIPCYLTC---------------
AqueK222_Aque_RGC  ----------V-L-F-----H---------------------------------------


HSER_Hsap_RGC      --------------------V---------------------------------------
CG10738_Dmel_RGC   -------------PT---------------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------SPE---------------------------------------------
Gyc76C_Dmel_RGC    ------------------------------------------------------------
CG4224_Dmel_RGC    ------------------------------------------------------------
CG3216_Dmel_RGC    ------------HPNPRRNDITWDDLNKDISLDSTTSLAGLNASDAGLEQRMYERSRESK
KSGC_Mmus_RGC      ------------------------------------------------------------
HSER_Mmus_RGC      --------------------V---------------------------------------
CYGX_Mmus_RGC      ------------------------------------------------------------
CYGF_Mmus_RGC      ------------------------------------------------------------
CYGD_Mmus_RGC      ------------------------------------------------------------
ANPb_Mmus_RGC      ------------------------------------------------------------
ANPa_Mmus_RGC      ------------------------------------------------------------
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ---R--------------------------------------------------------
gcy-8_Cele_RGC     ---A--------------------------------------------------------
gcy-7_Cele_RGC     ---PQ----V--------------------------------------------------
gcy-6_Cele_RGC     KYDIQ----T--------------------------------------------------
gcy-5_Cele_RGC     ---------CQ-------------------------------------------------
gcy-4_Cele_RGC     ---T--------------------------------------------------------
gcy-3_Cele_RGC     ---PV-------------------------------------------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------------
gcy-23_Cele_RGC    ---P--------------------------------------------------------
gcy-22_Cele_RGC    ------------------------------------------------------------
gcy-21_Cele_RGC    ----------IEL-----------------------------------------------
gcy-20_Cele_RGC    ------------------------------------------------------------
gcy-2_Cele_RGC     ---PD----TT-------------------------------------------------
gcy-19_Cele_RGC    ---TSSTTTTTPVPA---------------------------------------------
gcy-18_Cele_RGC    ---K--------------------------------------------------------
gcy-17_Cele_RGC    ------------------------------------------------------------
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ----------DAVPA---------------------------------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ---PD----TT-------------------------------------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------------------
CYGF_Hsap_RGC      ------------------------------------------------------------
ANPb_Hsap_RGC      ------------------------------------------------------------
ANPa_Hsap_RGC      ------------------------------------------------------------
CYGD_Hsap_RGC      ------------------------------------------------------------
T01A4.1_Cele_RGC   ------------PPSES-------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      --------------------I---------------------------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ------------------------------------------------------------
Gcy1_Spur_RGC      ------------NPT-----I---------------------------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  -------------PG---------------------------------------------
AqueK221_Aque_RGC  -------------PG---------------------------------------------
AqueK222_Aque_RGC  ------------------------------------------------------------


HSER_Hsap_RGC      ------------S--------------------------------------Q--------
CG10738_Dmel_RGC   ------------------------------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------------------------------------------------------
Gyc76C_Dmel_RGC    ------------------------------------------------------------
CG4224_Dmel_RGC    ------------A-----------------------------------------------
CG3216_Dmel_RGC    STQLSRYTEVGEM-----------------------------------------------
KSGC_Mmus_RGC      ------------------------------------------------------------
HSER_Mmus_RGC      ------------R--------------------------------------Q--------
CYGX_Mmus_RGC      ------------L-----------------------------------------------
CYGF_Mmus_RGC      ------------R-----------------------------------------------
CYGD_Mmus_RGC      ------------------------------------------------------------
ANPb_Mmus_RGC      ------------R-----------------------------------------------
ANPa_Mmus_RGC      ------------R-----------------------------------------------
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ------------R--------------------------------------DCSNRS---
gcy-8_Cele_RGC     ------------N--------------------------------------NGTEDNEIT
gcy-7_Cele_RGC     ---------------------------------------------------A--------
gcy-6_Cele_RGC     ---------------------------------------------------I--------
gcy-5_Cele_RGC     ---------------------------------------------------V--------
gcy-4_Cele_RGC     ---------------------------------------------------H--------
gcy-3_Cele_RGC     ---------------------------------------------------S--------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------------
gcy-23_Cele_RGC    ------------K--------------------------------------NSECRTGIS
gcy-22_Cele_RGC    ------------------------------------------------------------
gcy-21_Cele_RGC    ------------E-----------------------------------------------
gcy-20_Cele_RGC    ------------------------------------------------------------
gcy-2_Cele_RGC     ---------------------------------------------------V--------
gcy-19_Cele_RGC    ------------A-NRRTVGLRDFFTGPNFFMKIFTAKFEFYVFFLVYSGIF--------
gcy-18_Cele_RGC    ------------E--------------------------------------NGEKSSYTQ
gcy-17_Cele_RGC    ------------------------------------------------------------
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ------------P-----------------------------------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ---------------------------------------------------V--------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------------------
CYGF_Hsap_RGC      ------------Q-----------------------------------------------
ANPb_Hsap_RGC      ------------R-----------------------------------------------
ANPa_Hsap_RGC      ------------R-----------------------------------------------
CYGD_Hsap_RGC      ------------------------------------------------------------
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ------------T-----------------------------------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ------------------------------------------------------------
Gcy1_Spur_RGC      ------------I--------------------------------------N--------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ------------IND------------------------------------T--------
AqueK221_Aque_RGC  ------------VNE------------------------------------T--------
AqueK222_Aque_RGC  ------------------------------------------------------------


HSER_Hsap_RGC      ----------------------------------------N--------------C----
CG10738_Dmel_RGC   ------------------------------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------------------------------------------------------
Gyc76C_Dmel_RGC    ---------------------------------------CS--------------N----
CG4224_Dmel_RGC    ----------------------------------------TCREEPARDCEAICDA----
CG3216_Dmel_RGC    ----------------------------------------G--------------S----
KSGC_Mmus_RGC      ------------------------------------------------------------
HSER_Mmus_RGC      ----------------------------------------N--------------C----
CYGX_Mmus_RGC      ----------------------------------------A--------------W----
CYGF_Mmus_RGC      ----------------------------------------W--------------G----
CYGD_Mmus_RGC      ----------------------------------------S--------------A----
ANPb_Mmus_RGC      ----------------------------------------P--------------P----
ANPa_Mmus_RGC      ----------------------------------------S--------------G----
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ----PSP---------------HE-PYYS-----------T--------------R----
gcy-8_Cele_RGC     TSKGVSPN--------------TN-PLFLSN--STAGLYDS--------------K----
gcy-7_Cele_RGC     ---------------------------------------TG--------------T----
gcy-6_Cele_RGC     ---------------------------------------CQ--------------P----
gcy-5_Cele_RGC     ---------------------------------------IP--------------S----
gcy-4_Cele_RGC     ---------------------------------------GQ--------------G----
gcy-3_Cele_RGC     ---------------------------------------TG--------------T----
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------------
gcy-23_Cele_RGC    LSIGSYHEISEEGFKIWDNPTGVGPPLRLIAKIYTHFFAFR--------------Y----
gcy-22_Cele_RGC    ----------------------------------------P--------------V----
gcy-21_Cele_RGC    ----------------------------------------D-----------------IT
gcy-20_Cele_RGC    ----------------------------------------C--------------Q----
gcy-2_Cele_RGC     ---------------------------------------AP--------------K----
gcy-19_Cele_RGC    ---------------------------------------SS--------------K----
gcy-18_Cele_RGC    FDNGAKLEV------------------------------NK--------------E----
gcy-17_Cele_RGC    ----------------------------------------C--------------Q----
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ----------------------------------------G--------------Q----
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ----------------------------------------SP-------------EAEPS
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ---------------------------------------AP--------------R----
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------------------
CYGF_Hsap_RGC      ----------------------------------------Q--------------V----
ANPb_Hsap_RGC      ----------------------------------------P--------------P----
ANPa_Hsap_RGC      ----------------------------------------G--------------S----
CYGD_Hsap_RGC      ----------------------------------------P--------------A----
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ----------------------------------------T--------------A----
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ----------------------------------------Q--------------T----
Gcy1_Spur_RGC      ---------------------------------------ED--------------R----
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ---------------------------------------DA--------------D----
AqueK221_Aque_RGC  -------------------------------------------------------G----
AqueK222_Aque_RGC  ---------------------------------------CW--------------W----


HSER_Hsap_RGC      ---------------------HNG------------------------------------
CG10738_Dmel_RGC   ---------------------HGE------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ---------------------LQRPMTRVLLGAQLGELAWSPLFSGFAMGAMFYGYGLIH
Gyc76C_Dmel_RGC    ---------------------HRT------------------------------------
CG4224_Dmel_RGC    ---------------------NGR------------------------------------
CG3216_Dmel_RGC    ---------------------TMR------------------------------------
KSGC_Mmus_RGC      ----------------------AA------------------------------------
HSER_Mmus_RGC      ---------------------RNG------------------------------------
CYGX_Mmus_RGC      ---------------------ARE------------------------------------
CYGF_Mmus_RGC      ---------------------QAL------------------------------------
CYGD_Mmus_RGC      ---------------------LSA------------------------------------
ANPb_Mmus_RGC      ---------------------GAR------------------------------------
ANPa_Mmus_RGC      ---------------------HAS------------------------------------
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ---------------------TRC------------------------------------
gcy-8_Cele_RGC     ---------------------GRI------------------------------------
gcy-7_Cele_RGC     ---------------------TGN------------------------------------
gcy-6_Cele_RGC     ---------------------PGN------------------------------------
gcy-5_Cele_RGC     ---------------------SRR------------------------------------
gcy-4_Cele_RGC     ---------------------PRP------------------------------------
gcy-3_Cele_RGC     ---------------------TRP------------------------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    -----------------------D------------------------------------
gcy-23_Cele_RGC    ---------------------FQC------------------------------------
gcy-22_Cele_RGC    ---------------------NSA------------------------------------
gcy-21_Cele_RGC    VY--------------F-------------------------------------------
gcy-20_Cele_RGC    ---------------------FLQ------------------------------------
gcy-2_Cele_RGC     ---------------------TKR------------------------------------
gcy-19_Cele_RGC    ---------------------FEN------------------------------------
gcy-18_Cele_RGC    ---------------------HKR------------------------------------
gcy-17_Cele_RGC    ---------------------ARR------------------------------------
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ---------------------FLQ------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    LGAGANPYLLDSLVKRLPKKGDKK------------------------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ---------------------TKR------------------------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ---------------------EKI------------------------------------
CYGF_Hsap_RGC      ---------------------WTL------------------------------------
ANPb_Hsap_RGC      ---------------------GAR------------------------------------
ANPa_Hsap_RGC      ---------------------HAG------------------------------------
CYGD_Hsap_RGC      ---------------------LSA------------------------------------
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ---------------------GFS------------------------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ---------------------KNR------------------------------------
Gcy1_Spur_RGC      ---------------------GRT------------------------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ---------------------AKP------------------------------------
AqueK221_Aque_RGC  ---------------------SKL------------------------------------
AqueK222_Aque_RGC  ---------------------GN-------------------------------------


HSER_Hsap_RGC      ------------------------------------------------------------
CG10738_Dmel_RGC   ------------------------------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    LPSKGPLGCFFSRLRTAGLSVWQQCSPVMLVPWTLKVAQGLSLFPCHLWEFLANEVCLET
Gyc76C_Dmel_RGC    ------------------------------------------------------------
CG4224_Dmel_RGC    ------------------------------------------------------------
CG3216_Dmel_RGC    ------------------------------------------------------------
KSGC_Mmus_RGC      ------------------------------------------------------------
HSER_Mmus_RGC      ------------------------------------------------------------
CYGX_Mmus_RGC      ------------------------------------------------------------
CYGF_Mmus_RGC      ------------------------------------------------------------
CYGD_Mmus_RGC      ------------------------------------------------------------
ANPb_Mmus_RGC      ------------------------------------------------------------
ANPa_Mmus_RGC      ------------------------------------------------------------
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ------------------------------------------------------------
gcy-8_Cele_RGC     ------------------------------------------------------------
gcy-7_Cele_RGC     ------------------------------------------------------------
gcy-6_Cele_RGC     ------------------------------------------------------------
gcy-5_Cele_RGC     ------------------------------------------------------------
gcy-4_Cele_RGC     ------------------------------------------------------------
gcy-3_Cele_RGC     ------------------------------------------------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------------
gcy-23_Cele_RGC    ------------------------------------------------------------
gcy-22_Cele_RGC    ------------------------------------------------------------
gcy-21_Cele_RGC    ------------------------------------------------------------
gcy-20_Cele_RGC    ------------------------------------------------------------
gcy-2_Cele_RGC     ------------------------------------------------------------
gcy-19_Cele_RGC    ------------------------------------------------------------
gcy-18_Cele_RGC    ------------------------------------------------------------
gcy-17_Cele_RGC    ------------------------------------------------------------
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ------------------------------------------------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ------------------------------------------------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------------------
CYGF_Hsap_RGC      ------------------------------------------------------------
ANPb_Hsap_RGC      ------------------------------------------------------------
ANPa_Hsap_RGC      ------------------------------------------------------------
CYGD_Hsap_RGC      ------------------------------------------------------------
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ------------------------------------------------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ------------------------------------------------------------
Gcy1_Spur_RGC      ------------------------------------------------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ------------------------------------------------------------
AqueK221_Aque_RGC  ------------------------------------------------------------
AqueK222_Aque_RGC  ------------------------------------------------------------


HSER_Hsap_RGC      ---------------------------SYEI--SVLMMG-----N--------------S
CG10738_Dmel_RGC   ---------------------------VFTL--GYLTAS----QR--------------R
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    DNCLQHVILAFVLWIYLLILAITSLVSVVRL--NLQMLA----DR--------------H
Gyc76C_Dmel_RGC    ---------------------------VLTV--GYLTAL----TG--------------D
CG4224_Dmel_RGC    ---------------------------NCTIRALVLLPD----D---------------N
CG3216_Dmel_RGC    ---------------------------VYNV--GVLMAS----H---------------L
KSGC_Mmus_RGC      ---------------------------KLTV--GFHAPW-----N--------------I
HSER_Mmus_RGC      ---------------------------SYEI--SVLMMD-----N--------------S
CYGX_Mmus_RGC      ---------------------------TFTL--GVLGPW----DC---------------
CYGF_Mmus_RGC      ---------------------------PYKI--GVIGPW----TC---------------
CYGD_Mmus_RGC      ---------------------------VFKV--GVLGPW----AC---------------
ANPb_Mmus_RGC      ---------------------------NLTL--AVVLPE----HN--------------L
ANPa_Mmus_RGC      ---------------------------DLTV--AVVLPL----TN--------------T
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ---------------------------SKNV--R--RRF----EN---------------
gcy-8_Cele_RGC     ---------------------------RLTI--GHIGAI----GA---------------
gcy-7_Cele_RGC     ---------------------------VIRV--GFIHCR----DF--------------Q
gcy-6_Cele_RGC     ---------------------------VFHL--GFLHCDVLENNV--------------E
gcy-5_Cele_RGC     ---------------------------TLRV--GIAAAQ----DT--------------Q
gcy-4_Cele_RGC     ---------------------------VIRV--GITAAL----KT--------------E
gcy-3_Cele_RGC     ---------------------------KLKV--GIAAAQ----KT--------------Q
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ---------------------------SFQI--GHLEFE----NS--------------N
gcy-23_Cele_RGC    ---------------------------VVKV--GHIGAV----GS---------------
gcy-22_Cele_RGC    ---------------------------VLQV--GFLAAN----DN--------------T
gcy-21_Cele_RGC    ---------------------------PLKV--DYLAP----------------------
gcy-20_Cele_RGC    ---------------------------TIKV--GLMFSK----DT--------------A
gcy-2_Cele_RGC     ---------------------------TIKI--GIAAAQ----RT--------------Q
gcy-19_Cele_RGC    ---------------------------RIRV--GVAAVQ----TT--------------E
gcy-18_Cele_RGC    ---------------------------VIKI--GHIGAV----GV---------------
gcy-17_Cele_RGC    ---------------------------TIKV--GLLFVQ----NV--------------S
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ---------------------------TVKV--GLLFSK----DT--------------A
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ---------------------------EILI--SYLAAV----PTLMGEIDQYLLNLSAS
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ---------------------------TIKI--GIAAAQ----RI--------------Q
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ---------------------------VLKI--GSISSR----DN---------------
CYGF_Hsap_RGC      ---------------------------PYKI--GVVGPW----AC---------------
ANPb_Hsap_RGC      ---------------------------NLTL--AVVLPE----HN--------------L
ANPa_Hsap_RGC      ---------------------------NLTV--AVVLPL----AN--------------T
CYGD_Hsap_RGC      ---------------------------VFTV--GVLGPW----AC---------------
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ---------------------------SCT-DLHLL-MI----HG--------------T
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ---------------------------AIKT--IILH-R----AC--------------Q
Gcy1_Spur_RGC      ---------------------------KIHV--GLLAEW----TT--------------A
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ---------------------------QVRI--GVMFDF----PL--------------L
AqueK221_Aque_RGC  ---------------------------QVRI--GVILDF----PS--------------N
AqueK222_Aque_RGC  ----------------------------ASV--SNPDPI----DC--------------H


HSER_Hsap_RGC      ------------------------A----FAEPLKNLED--------------AVNEGLE
CG10738_Dmel_RGC   ------------------------PGNLDYNRPGLTISG--------------AI----S
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------------------IHSRDHELRAYVTLG--------------GL----P
Gyc76C_Dmel_RGC    ------------------------L----KTRQGLAISG--------------AL----T
CG4224_Dmel_RGC    ------------------------M----YQASLPRVLP--------------IL----K
CG3216_Dmel_RGC    ------------------------D----SPFDLERCGP--------------AV----D
KSGC_Mmus_RGC      ------------------------S----HPFSVQRLGA--------------GL----Q
HSER_Mmus_RGC      ------------------------A----YKEPMQNLRE--------------AVEEGLD
CYGX_Mmus_RGC      ------------------------D----PIFAQALPSI--------------AT----Q
CYGF_Mmus_RGC      ------------------------D----PFFSKALPEV--------------AA----A
CYGD_Mmus_RGC      ------------------------D----PIFARARPDL--------------AA----R
ANPb_Mmus_RGC      ------------------------S----YAWAWPRVGP--------------AV----A
ANPa_Mmus_RGC      ------------------------S----YPWSWARVGP--------------AV----E
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ---------------------------------EKYSST--------------KL----Y
gcy-8_Cele_RGC     ---------------------------------LRNDVK--------------IL----E
gcy-7_Cele_RGC     ------------------------S--APITVGYRTSAA--------------AA----S
gcy-6_Cele_RGC     ------------------------G--STTYINYRTSAS--------------AA----S
gcy-5_Cele_RGC     ------------------------S----GSIGWASCGG--------------TL----P
gcy-4_Cele_RGC     ------------------------N----GSIGWAYTGG--------------AV----P
gcy-3_Cele_RGC     ------------------------S----ASIGWNVCGG--------------AV----P
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------E----T--------R--------------IL----E
gcy-23_Cele_RGC    ---------------------------------MRNAEK--------------IL----Q
gcy-22_Cele_RGC    ------------------------T-ELAPFIGWGQVAG--------------AL----G
gcy-21_Cele_RGC    ------------------------------------------------------------
gcy-20_Cele_RGC    ------------------------S--VIRSVGYRTSAA--------------AV----L
gcy-2_Cele_RGC     ------------------------T----SSIGWSVCGG--------------AV----P
gcy-19_Cele_RGC    ------------------------L----DSIGWPMSGG--------------AI----N
gcy-18_Cele_RGC    ---------------------------------MPNDAR--------------IL----N
gcy-17_Cele_RGC    ------------------------S--LQVGIGYRTSAA--------------AV----L
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------S--VMRAVGYRTSAA--------------AV----L
gcy-13_Cele_RGC    -------------------------------VGWQTSAS--------------AI----E
gcy-12_Cele_RGC    NSAQNSSKDRESFSKKLNQIVHCLT----TDAYVSVVSG--------------AL----V
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ------------------------T----SSIGWSVCGG--------------AV----P
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ---------------------------------AKMLES--------------IL----E
CYGF_Hsap_RGC      ------------------------D----SLFSKALPEV--------------AA----R
ANPb_Hsap_RGC      ------------------------S----YAWAWPRVGP--------------AV----A
ANPa_Hsap_RGC      ------------------------S----YPWSWARVGP--------------AV----E
CYGD_Hsap_RGC      ------------------------D----PIFSRARPDL--------------AA----R
T01A4.1_Cele_RGC   ----------------------------------QKNGG--------------LT----P
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ------------------------Y----GLMSYQYNDP--------------AI----D
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      -------------------------------LNEIHLRP--------------AI----D
Npr4_Spur_RGC      -----------------------------YSVDHRSILV--------------RS----S
Gcy1_Spur_RGC      ------------------------DG--DQGTLGFPALG--------------AL----P
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ------------------------P----NETQVYEEAGLEPGDVLPGKLLIPYS----P
AqueK221_Aque_RGC  ------------------------A----NETKLLQSAGLNPEDLLPGDMLLPYS----P
AqueK222_Aque_RGC  -----------------------------DISLAWNE-----------------------


HSER_Hsap_RGC      IVR------GRLQNAG--LN-V-TVN-A--------------------------------
CG10738_Dmel_RGC   LAV------EEVNAGR--LRDR-GHS-L--------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    LAI------EDVNKNP--NLLP-GKK-L--------------------------------
Gyc76C_Dmel_RGC    MAL------DEVNKDP--NLLP-NVY-L--------------------------------
CG4224_Dmel_RGC    VAE------QQIRSK---SLIPSHID-F--------------------------------
CG3216_Dmel_RGC    LAL------DEINKV----FLKP-HN-I--------------------------------
KSGC_Mmus_RGC      TVV------DKLNSEP--VGLG-NVS-W--------------------------------
HSER_Mmus_RGC      IVR------KRLREAD--LN-V-TVN-A--------------------------------
CYGX_Mmus_RGC      LAV------DQVNQDA--SLLP-GSQ-L--------------------------------
CYGF_Mmus_RGC      LAI------ERISRDK--TFDR-SYS-F--------------------------------
CYGD_Mmus_RGC      LAA------NRLNRDF--ALDG-GPR-F--------------------------------
ANPb_Mmus_RGC      LAV------EALGRA----L---PVD-L--------------------------------
ANPa_Mmus_RGC      LAL------GRVKARP--DLLP-GWT-V--------------------------------
odr-1_Cele_RGC     ----------RINQ----------------------------------------------
gcy-9_Cele_RGC     FNV------RSLNLK---K--TSLSN-F--------------------------------
gcy-8_Cele_RGC     VSH------KALQAE---GILDDDLD-V--------------------------------
gcy-7_Cele_RGC     IAV------DRLKRE---NLMS-GWE-F--------------------------------
gcy-6_Cele_RGC     IAI------DKIKRE---GLLL-GYD-F--------------------------------
gcy-5_Cele_RGC     IAV------QYLKSK---GFLT-DFD-V--------------------------------
gcy-4_Cele_RGC     LAL------QYLKSH---GYML-NFD-F--------------------------------
gcy-3_Cele_RGC     LAI------ERLKQA---GYVT-NFD-F--------------------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ICM------K---NA---G---SWRD-H--------------------------------
gcy-23_Cele_RGC    LSK------EQLTQE---GVLGNDFD-I--------------------------------
gcy-22_Cele_RGC    VAW------SRIVEY---GLLP-GYETM--------------------------------
gcy-21_Cele_RGC    ---------------F--GC----------------------------------------
gcy-20_Cele_RGC    VAK------DRIRAE---HLLD-QYD-F--------------------------------
gcy-2_Cele_RGC     MAI------ERLREF---GYVK-DFD-F--------------------------------
gcy-19_Cele_RGC    MAI------QKLRDD---GFIA-PFD-F--------------------------------
gcy-18_Cele_RGC    ISK------ENLIEE---GLVGDDIE-F--------------------------------
gcy-17_Cele_RGC    VTK------NKIRED---HVLD-GFD-FEKLRNVLKFSTKFQNIPDFFSSALKWPRKFYI
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    VAR------DRIRAE---HLLD-QYD-F--------------------------------
gcy-13_Cele_RGC    IAM------DRIKSE---HLID-NIG-I--------------------------------
gcy-12_Cele_RGC    AAI------VEINQDK--DLIP-AYQ-L--------------------------------
gcy-11_Cele_RGC    --------------N---------------------------------------------
gcy-1_Cele_RGC     LAI------ERLKEM---GFVK-DFD-F--------------------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   MAK------KKMTEQ---GVLGEKLD-I--------------------------------
CYGF_Hsap_RGC      LAI------ERINRDP--SFDL-SYS-F--------------------------------
ANPb_Hsap_RGC      LAV------EALGRA----L---PVD-L--------------------------------
ANPa_Hsap_RGC      LAL------AQVKARP--DLLP-GWT-V--------------------------------
CYGD_Hsap_RGC      LAA------ARLNRDP--GLAG-GPR-F--------------------------------
T01A4.1_Cele_RGC   NSL------QKAE-----------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      IAV------EEIRRRVTEGEYV-NIS-L--------------------------------
Gcy3_Spur_RGC      --S------D--------------------------------------------------
Npr3_Spur_RGC      IAF------EKVNNGAARGLYL-NFS-M--------------------------------
Npr4_Spur_RGC      LSW------HRLDNTA---F----------------------------------------
Gcy1_Spur_RGC      LAI------SLANQDS--NILN-GFD-V--------------------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  LAVSAYKQAVKINANP--AILP-YHH-L--------------------------------
AqueK221_Aque_RGC  LALITYETAKRLNLNS--TVLP-EHY-I--------------------------------
AqueK222_Aque_RGC  ----------EPPSEV--RVGQ-RFN-V--------------------------------


HSER_Hsap_RGC      ------------------------------------------------------------
CG10738_Dmel_RGC   ------------------------------------------------------------
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------------------------------------------------------
Gyc76C_Dmel_RGC    ------------------------------------------------------------
CG4224_Dmel_RGC    ------------------------------------------------------------
CG3216_Dmel_RGC    ------------------------------------------------------------
KSGC_Mmus_RGC      ------------------------------------------------------------
HSER_Mmus_RGC      ------------------------------------------------------------
CYGX_Mmus_RGC      ------------------------------------------------------------
CYGF_Mmus_RGC      ------------------------------------------------------------
CYGD_Mmus_RGC      ------------------------------------------------------------
ANPb_Mmus_RGC      ------------------------------------------------------------
ANPa_Mmus_RGC      ------------------------------------------------------------
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ------------------------------------------------------------
gcy-8_Cele_RGC     ------------------------------------------------------------
gcy-7_Cele_RGC     ------------------------------------------------------------
gcy-6_Cele_RGC     ------------------------------------------------------------
gcy-5_Cele_RGC     ------------------------------------------------------------
gcy-4_Cele_RGC     ------------------------------------------------------------
gcy-3_Cele_RGC     ------------------------------------------------------------
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------------
gcy-23_Cele_RGC    ------------------------------------------------------------
gcy-22_Cele_RGC    ------------------------------------------------------------
gcy-21_Cele_RGC    ------------------------------------------------------------
gcy-20_Cele_RGC    ------------------------------------------------------------
gcy-2_Cele_RGC     ------------------------------------------------------------
gcy-19_Cele_RGC    ------------------------------------------------------------
gcy-18_Cele_RGC    ------------------------------------------------------------
gcy-17_Cele_RGC    ISEVLNFLEVLKMLENFFRIFQKISEVSRIFSNFPEISRRFLNCSQIFQQFPEVFRFFKE
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------------------------------------------
gcy-13_Cele_RGC    ------------------------------------------------------------
gcy-12_Cele_RGC    ------------------------------------------------------------
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ------------------------------------------------------------
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------------------
CYGF_Hsap_RGC      ------------------------------------------------------------
ANPb_Hsap_RGC      ------------------------------------------------------------
ANPa_Hsap_RGC      ------------------------------------------------------------
CYGD_Hsap_RGC      ------------------------------------------------------------
T01A4.1_Cele_RGC   ------------------------------------------------------------
Npr1_Spur_RGC      ------------------------------------------------------------
Npr2_Spur_RGC      ------------------------------------------------------------
Gcy3_Spur_RGC      ------------------------------------------------------------
Npr3_Spur_RGC      ------------------------------------------------------------
Npr4_Spur_RGC      ------------------------------------------------------------
Gcy1_Spur_RGC      ------------------------------------------------------------
Gcy2_Spur_RGC      ------------------------------------------------------------
Npr5_Spur_RGC      ------------------------------------------------------------
AqueK220_Aque_RGC  ------------------------------------------------------------
AqueK221_Aque_RGC  ------------------------------------------------------------
AqueK222_Aque_RGC  ------------------------------------------------------------


HSER_Hsap_RGC      ------------------------------------------------------TFMYSD
CG10738_Dmel_RGC   ------------------------------------------------------QFVVAE
CG9783_Dmel_RGC    ------------------------------------------------------------
Gyc32E_Dmel_RGC    ------------------------------------------------------AFKPVD
Gyc76C_Dmel_RGC    ------------------------------------------------------DLRWND
CG4224_Dmel_RGC    ------------------------------------------------------EWLAH-
CG3216_Dmel_RGC    ------------------------------------------------------TLLKKK
KSGC_Mmus_RGC      ------------------------------------------------------EFTY--
HSER_Mmus_RGC      ------------------------------------------------------TFIYSD
CYGX_Mmus_RGC      ------------------------------------------------------DFKVL-
CYGF_Mmus_RGC      ------------------------------------------------------EYVIL-
CYGD_Mmus_RGC      ------------------------------------------------------EVALL-
ANPb_Mmus_RGC      ------------------------------------------------------RFVSSE
ANPa_Mmus_RGC      ------------------------------------------------------RMVLGS
odr-1_Cele_RGC     ------------------------------------------------------------
gcy-9_Cele_RGC     ------------------------------------------------------SVF-T-
gcy-8_Cele_RGC     ------------------------------------------------------EII-S-
gcy-7_Cele_RGC     ------------------------------------------------------NFTIE-
gcy-6_Cele_RGC     ------------------------------------------------------KFTIL-
gcy-5_Cele_RGC     ------------------------------------------------------EYYME-
gcy-4_Cele_RGC     ------------------------------------------------------EFHVE-
gcy-3_Cele_RGC     ------------------------------------------------------EYYVE-
gcy-27_Cele_RGC    ------------------------------------------------------------
gcy-25_Cele_RGC    ------------------------------------------------------R-LIS-
gcy-23_Cele_RGC    ------------------------------------------------------EIL-N-
gcy-22_Cele_RGC    ------------------------------------------------------NLTWV-
gcy-21_Cele_RGC    --------------------------------------------------------ATG-
gcy-20_Cele_RGC    ------------------------------------------------------NFTIK-
gcy-2_Cele_RGC     ------------------------------------------------------EFIVD-
gcy-19_Cele_RGC    ------------------------------------------------------EVTVN-
gcy-18_Cele_RGC    ------------------------------------------------------EIV-S-
gcy-17_Cele_RGC    FSESSQKTFPEVSRIFSNISGVSKRLRNYFKFSEVSKKFSGGSKNVSNISKVSRRFLWD-
gcy-15_Cele_RGC    ------------------------------------------------------------
gcy-14_Cele_RGC    ------------------------------------------------------NFTVK-
gcy-13_Cele_RGC    ------------------------------------------------------NFIYV-
gcy-12_Cele_RGC    ------------------------------------------------------KYVFG-
gcy-11_Cele_RGC    ------------------------------------------------------------
gcy-1_Cele_RGC     ------------------------------------------------------EYIVD-
daf-11_Cele_RGC    ------------------------------------------------------------
C04H5.4_Cele_RGC   ------------------------------------------------