Protein (view, download) , Domain (view, download)
10066_Tthe      MIQERE--N------------------QL-------------------------------
10118_Tthe      MINSQVKAS-KV---------------KES-LFDDLDQ-NTRESYKM-------------
10195_Tthe      MSDIISGDT-QNV---------------KL-----------VK-----------------
1090_Tthe       MR----------------------------------------------------------
11510_Tthe      MNKHSFWVK-TI------------------------------------------------
11511_Tthe      MQSQTITQN-NHA------------------------------NPQV-------------
12415_Tthe      MKPASFFDD-DY---------------GK------------LQ-KKI-------------
13229_Tthe      MKNMYNRA-YREA--------------DDS-FFDDSYGVSGIHSNEF-------------
14827_Tthe      MSTQSQLKK-SID---------------ANTCYEC----NVIKSSSI-------------
15541_Tthe      MKGGVYQKQYRET--------------DDS-FFYDDF----YNPQEF-------------
17681_Tthe      MENSLLQDS-LE---------------------------------FY-------------
2256_Tthe       MSKKNIKKE-EAS---------------QQ-I----------T-----------------
23204_Tthe      MANQFLKNQ-QPCSIQLVSNQTLQQSVEKS-M---------NM-QK-DLPNVSKFEQLKR
23205_Tthe      MGCAKSVEV-KK-----------------S-I---------AS-QR--------------
23956_Tthe      MGCGITRES-EV---------------KES-L---------NQ-RGDG------------
2623_Tthe       MGCTTSKSS-KSN---------------SN-----------GE-----------------
27560_Tthe      M-----------------------------------------------------------
27680_Tthe      MSDKGF------------------------------------------------------
3709_Tthe       MGCTNAKQK-KE-----------------Q-K-------------DPN------------
4137_Tthe       MSSETKSGN-TTP--------------GK------------AQKGKI-------------
4750_Tthe       MGCVTSKTN-DN-----------------A-I---------SR-KKPE------------
7304_Tthe       MGVVVISDM-IRV---------------------------------E-------------
8030_Tthe       MNKDVIQSP-NSM---------------QSQ--------------QM-------------
9801_Tthe       SDKSITVEP-S-----------------VF-----------VQ-----------------
6435_Tthe       MNIEKRGGY-D-------------------------------------------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      -WSKNIPLIP-----------------------------------KKT-DQR-SIEGT--
10195_Tthe      --TNCSQNEE--------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      ------PSLD-----------------------------------AEK-ELF-HVSAY--
11511_Tthe      -WTVCNNCKD-----------------------------------YDQ-DTV-QFAGQ--
12415_Tthe      -WDPVP-GNK---------------------------------TVSNL-ETV-YLCNQ--
13229_Tthe      -WIKCEEYDK-----------------------------------FDQ-SEM-TFQGR--
14827_Tthe      ---RPINK-----------------------------------SQFSQ-NQI-IHESVMD
15541_Tthe      -WIKLNDGDK-----------------------------------PDE-DQI-IFQGR--
17681_Tthe      -WISGNEENKL--------------------------------HLPDN-EVC-LLSSK--
2256_Tthe       -----TKN-----------------------------------GVFDY-SQC-LFEVR--
23204_Tthe      ITLEINDGKYLPQLKSNTALATYDIIAIKTRNEKVFHSLCIDYDDYDI-LCF-DMSERL-
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------KGQS--------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      -WIKVNKGAQ-----------------------------------LPK-EPV-LAEGY--
3709_Tthe       ------------------------------------------------------------
4137_Tthe       -WTKLSKGNN---------------------------------QHPDK-SQL-IIADY--
4750_Tthe       ------------------------------------------------------------
7304_Tthe       -WLVKEGPDGT--------------------------------NAFDRCEGFRIEKDD--
8030_Tthe       -----------------------------------------------Q-SSL--TDSI--
9801_Tthe       --R---------------------------------------------------------
6435_Tthe       -----------------------------------------------Y-SDC-SFEVR--


10066_Tthe      ------------------------------------------------------------
10118_Tthe      ------------------------------------------------------------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      ------------------------------------------------------------
11511_Tthe      ------------------------------------------------------------
12415_Tthe      ------------------------------------------------------------
13229_Tthe      ------------------------------------------------------------
14827_Tthe      LNTGIEEVFNLNRKSRIEWIWDNNQFKNNVNNFEGFVLCLS-------------------
15541_Tthe      ------------------------------------------------------------
17681_Tthe      ------------------------------------------------------------
2256_Tthe       ------------------------------------------------------------
23204_Tthe      -----------------PFIPKRGWIQEAVRKGISFEICYSEAIEDPAKKRTVLANCINI
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      ------------------------------------------------------------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       ------------------------------------------------------------
4750_Tthe       ------------------------------------------------------------
7304_Tthe       ------------------------------------------------------------
8030_Tthe       ------------------------------------------------------------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       ------------------------------------------------------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      --LFR------------------------------------------K------------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      --ICD------------------------------------------S------------
11511_Tthe      --ISD------------------------------------------S------------
12415_Tthe      --FYK------------------------------------------R------------
13229_Tthe      --LYQ------------------------------------------K------------
14827_Tthe      --LEP------------------------------------------ENKQEKDIMNIKM
15541_Tthe      --LYQ------------------------------------------K------------
17681_Tthe      --FKK------------------------------------------R------------
2256_Tthe       --LTK------------------------------------------K------------
23204_Tthe      VKMTKGKNIIFSSSCSSDFDHRSPFDIIMLGTLIGLTRDQTHDALKKF------------
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      --FSK------------------------------------------K------------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       --FSK------------------------------------------Q------------
4750_Tthe       ------------------------------------------------------------
7304_Tthe       --IYQ------------------------------------------R------------
8030_Tthe       ------------------------------------------------------------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       --LTK------------------------------------------R------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      ----SIKK--GYWKSNTYQLIGNKLIKF-T------AE-SGKPE----------------
10195_Tthe      ----------YQ------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      ----LENS-QDQNQNGVLKIYEQKLIYC-I------QE---------T------------
11511_Tthe      ----KDPF-SSVFGEGFIRVNQEKITFS-Q------QG---------F------------
12415_Tthe      ----SKKV--GKSKQIYYVLTEEGLYQV-K------KN---------E------------
13229_Tthe      ----NPKT--KKWQAYHFELYSDRLIRI-S------AG-NGNSNN-----SQ------NA
14827_Tthe      NLRTSQQVNKTEAQNSNYDKN-------YNI---NNNN---------N----------N-
15541_Tthe      ----AGKH--KKWTAYHFELYSDKLIRF-D------LT-QLKTNNADAKKDQAAMQAKNP
17681_Tthe      ----IGDS--QQYEECELKLYGKRLYLI-Q------RN---------Q------------
2256_Tthe       -----GFL--GQSTR-YVYCTKNSIVVA-K------EPYQKKPD----------------
23204_Tthe      ----PSNC--IKRSR-YRKTYEGTISHA-S------KND---------M---------E-
23205_Tthe      --------------R---------------------------------------------
23956_Tthe      --------------S---------------------------------------------
2623_Tthe       ----------NQ------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      -----GNY--MSGKR-YFKLYDNFIYYF-D------EK---------NS---------D-
3709_Tthe       --------------K---------------------------------------------
4137_Tthe       -----GKI--MKSKR-YFELYPTQIYYY-S------EK---------DH---------N-
4750_Tthe       --------------K---------------------------------------------
7304_Tthe       ----AKAA--L-EKDA-ASI--DPLHLF-N------SQ-------QQSK---------E-
8030_Tthe       ETRSSKSISDTSNKNYSFDYSGCQMHCFYDIVKWVVQK---------S----------D-
9801_Tthe       ------------------------------------------------------------
6435_Tthe       -----KFL--HSVLR-YVYFARDKIVVC-K------EPYQKKPE----------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      ----------------------------K-----FAN-----------------------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      --------------------------NVC-----FIQ-----------------------
11511_Tthe      --------------------------VTA-----FIK-----------------------
12415_Tthe      -----VLC--------------------G-----FMD-----------------------
13229_Tthe      VNNNNNQNGQIQNQANSENANKE--ELPE-----YLP-----------------------
14827_Tthe      -----NK---QENAGVQENNF-------S-----LKS-----------------------
15541_Tthe      DANNQTQ-TPNSNQSIQQPNQPEEGVVAE-----YIP-----------------------
17681_Tthe      -----VI---------------------A-----FLK-----------------------
2256_Tthe       ----------------------------K-----IIN-----------------------
23204_Tthe      -----EFK--------------------KKNEAQI-ERIQKKVKKNEEISQQIQSSADKN
23205_Tthe      ----------------------------------I-------------------------
23956_Tthe      ----------------------------------VQK-----------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      -----HPK--------------------G-----YIK-----------------------
3709_Tthe       ----------------------------------VRK-----------------------
4137_Tthe       -----QPK--------------------G-----YTD-----------------------
4750_Tthe       ----------------------------------VIT-----------------------
7304_Tthe       -----AKQ--------------------G-----QAN-----------------------
8030_Tthe       -----TQ-----------------------------------------------------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       ----------------------------K-----IIK-----------------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      ------------------------------IENY----RLE----KI----KL-------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      ------------------------------L---NEEIQYNTYFD----R----------
11511_Tthe      ------------------------------I---LEQLTYSTLYN----D----------
12415_Tthe      ------------------------------LTCVKMDLLIEV-QD--AKTIDT-------
13229_Tthe      ------------------------------LNAC----YLK----KI----KY-------
14827_Tthe      ------------------------------L---NQEGLSSSMPD---IEK---------
15541_Tthe      ------------------------------INSC----FLK----KI----KY-------
17681_Tthe      ------------------------------F---CFEMTFELVID--GDK-DH-------
2256_Tthe       ------------------------------L---KPDWQVAWIYD--AKKIKE-------
23204_Tthe      NLKLKLLERNKKISVMENKSNILFDKESQKI---DFDPNQNVFLN--PKRVKYPTNPNNQ
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      ------------------------------I---DFDLHFEVIR----QKTDK-------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       ------------------------------L---SFELCFELMREKVAENKDK-------
4750_Tthe       ------------------------------------------------------------
7304_Tthe       -----------------------------------------------GE--SK-------
8030_Tthe       ------------------------------L---TYTGMILTIRK---EKE---------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       ------------------------------L---NTRYTIKWIYN--PKKIDR-------


10066_Tthe      -----------------------------GFEDLSEG--QIAT-LLK---KYAL------
10118_Tthe      -----------EE---KGD---------------KDIKYGFRL-T---------------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      ----------------------------------AKGINYIKF-Q---------------
11511_Tthe      ----------------------------------D--ACYLKL-S---------------
12415_Tthe      -----------SLD---SN---------------PNNVHGFRL-S---------------
13229_Tthe      -----------SD---TSY---------------ANYKYGIRL-Q---------------
14827_Tthe      ------------DQ-------------------------NVK------------------
15541_Tthe      -----------SD---NSY---------------SNYKYGIRL-Q---------------
17681_Tthe      -----------ELE--NIK---------------QHNFKSLKI-E---------------
2256_Tthe       -----------P------F---------------EKKILGFKL-I---------------
23204_Tthe      KESNQMQIEEEKKNQ---PTDIK-QNNSNN-----NNNTSVQE-NKEEQKPKLLSFILYY
23205_Tthe      ------------------------SNTRIK-----Q------------------------
23956_Tthe      --------------------VSDIKVNNLNFIDEASR--KITD-DYE--ISEII------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      ------------------------------------------------------------
27680_Tthe      -----------KDNSPSSI---------------IGQPKGLRL-D---------------
3709_Tthe       ------------------PNAYLA---EDKFWDDP----SIKD-N---------------
4137_Tthe       -----------KDD--KVK---------------LGKPKGIKL-D---------------
4750_Tthe       -------------------NKRKIEDNTSSFWDTQSQNNGLQQ-N---------------
7304_Tthe       -----------KNSTTTTL---------------EEQQKNIEQND---------------
8030_Tthe       ------------DKT------------------------FEK------------------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       -----------P------F---------------KEKAIGFSI-L---------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      --------H-------------------N----CKFVELYARNKEHM----------LMW
10195_Tthe      -----------------------------------------MKQ-QF----------IVN
1090_Tthe       ------------------------------------------------------------
11510_Tthe      --------K-------------------N----QIHTYIVMSEQ-EI----------ALV
11511_Tthe      --------K-------------------F----GKETFVKMSPD-AL----------DQV
12415_Tthe      --------R-------------------N----GKSIEFYTNDNLLY----------KNW
13229_Tthe      --------K-------------------G----ELKSELFTESAENF----------NKL
14827_Tthe      ----------------------------------IQTICYFTDLESR----------SHV
15541_Tthe      --------R-------------------G----EHKSELFTENSDTF----------N--
17681_Tthe      --------K-------------------D----MCDCEFINEDKKVY----------VEW
2256_Tthe       --------T-------------------DT---DVKI-EYFGDVVVM----------TTL
23204_Tthe      KSKYLDIEEIKNEQTKKCILIFHFECGKMGCSSSISTEVSSSEKKIKRIQNQKVIKQLSW
23205_Tthe      ---------------------------------------------------------LDW
23956_Tthe      ------------------------------------------------------------
2623_Tthe       -----------------------------------------N-P-SA----------AKY
27560_Tthe      ------------------------------------------------------------
27680_Tthe      --------K-------------------L----NAKTEITTNDEALI----------LKW
3709_Tthe       ------------------------------------------------------------
4137_Tthe       --------K-------------------S----GCVCELYSPEDKVL----------IKW
4750_Tthe       ------------------------------------------------------------
7304_Tthe       --------Q------------------FR----QIIIEIFLKEPILL----------KKV
8030_Tthe       ----------------------------------IEDFEFIGDSIIL----------EQV
9801_Tthe       ------------------------------------------------------------
6435_Tthe       --------N-------------------DK---DESITQFYGDNIIM----------TCL


10066_Tthe      -----IFQIFLAYIKNIQY-------------Y------QKKV-----------------
10118_Tthe      FE----LVKRQCVLTTFQN--D--YST-IKLMGKG---NFARV-----------------
10195_Tthe      KQ----MFFRYSNKKKIRD--D--YKF-LKELGSG---AFGVV-----------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      DH----QLNKIIFKNDFYS--S--YDI-IDLIGNG---TYSQV-----------------
11511_Tthe      DK----LLKNIIFKQDFSD--S--YEV-ISFVGNG---SFS-------------------
12415_Tthe      KN----VLIYRCIQSTFHE--E--FIV-TKMIGKG---SFAKV-----------------
13229_Tthe      YE----EIKRFCILPKFAK--K--YKV-LTKFKSPSQMPNAHL-----------------
14827_Tthe      IQ----YFKMRVIQRNFHQ--V--YKA-VRKLGKG---SFASVLIFDIYIFLKKTPATYW
15541_Tthe      ------------------------------------------------------------
17681_Tthe      QS----KLSEKITQKNFYA--Y--YDV-KRVIGSG---AYASV-----------------
2256_Tthe       RD----YFCKQLFQIKFLD--E--FEI-QKKIGKG---KYAKV-----------------
23204_Tthe      DKNSNQDETTIASIENIEF--F--YEF-IKQIGQG---QFGSV-----------------
23205_Tthe      YDKDDKNETTIASIENIDY--F--YEI-IKPLGKG---TYGCV-----------------
23956_Tthe      -----YFNKFVKSIESITFKQNKQTNI-KMKFK------KGHV-----------------
2623_Tthe       QD----NKIETSEIKS-TL--P--F-K-INILRTG---AFGVV-----------------
27560_Tthe      -------------------------------IGKG---GFSRV-----------------
27680_Tthe      RD----ILRNKINQRGFHE--L--FKA-HKKIGKG---NFASV-----------------
3709_Tthe       ---K-QREQTIASIENIHY--F--YKF-ERKLGSG---SFGSV-----------------
4137_Tthe       RD----ALRKILNQRGFHE--L--FRA-HKKIGKG---NFASV-----------------
4750_Tthe       ---TDKDECTISSIENIYY--Y--YKF-LKKLGNG---AFGSV-----------------
7304_Tthe       YN----YFAPRVIMKQFHD--H--YKA-VKKLGKG---SFASV-----------------
8030_Tthe       KD----YLRRYIFQTRIQD--E--F-----------------------------------
9801_Tthe       ---------KLGSFDKLCE--E--YDILNKKLGEG---FFGSV-----------------
6435_Tthe       LD----FLQKQIFQADFLN--E--YEI-ITKIGKG---KYAKV-----------------


10066_Tthe      -------------FKVQR-IQDGKIFAAKVIKRAKLEENKYKDKFVAMLLNEYRVLSES-
10118_Tthe      -------------YYARSK-LTGGEFAVKAFEKDKFAQI---EIDRPALIKEISILRKM-
10195_Tthe      -------------FLATHR-ITGDERAVKAVAKDRLSD-------KQQFQDEINILKEL-
1090_Tthe       --------------------------------------------------------NLR-
11510_Tthe      -------------SLARHK-VTGKKFAVKNISKNRVNSS---LQNKRELMNEINLLRRL-
11511_Tthe      ---------------------------------------------QKELMNEINLLRRI-
12415_Tthe      -------------YLATKK-SQNIQYAIKAFNKEFMQNQ---HKGKESLINEISIMRQL-
13229_Tthe      -------------YKCFRY-SDSTQYCVRIIDKYTLTD-----QGRISVLKETAILRKI-
14827_Tthe      LTLLLILHCVNKVYLVNLV-GTNKHFAIKAFLKEKLIEE---EKGYESFYNEIMLMRCI-
15541_Tthe      -----------------------------------------------KWHDEIKRFYIA-
17681_Tthe      -------------VIAEKK-IDGSLFAVKSLSKAHIYQT---TDGKAEIENELALMRLV-
2256_Tthe       -------------YKVRRK-DNNQLYAVKYLHKMKLATI---EDAQAALFNELKILRMI-
23204_Tthe      -------------FLAKRRKQPFDEVAIKIINLNQIKK-----IPLQYIKREVQISKSL-
23205_Tthe      -------------YHAKQKREPQREVAIKVISLNNIDK-----LPLQYVKREVQISKIL-
23956_Tthe      -------------KKVVK-KDTKEERVMKIVNKKYVDN----SVNNFNITNEIIYLSQL-
2623_Tthe       -------------RLVEQR-QTGLRRAMKSIKKSNIIKE-----EEEKMFAEVNILSTL-
27560_Tthe      -------------FLAQDK-FSRENYAIKVITKDKLLQQ---TKGIKSLLNEIQIMKEL-
27680_Tthe      -------------YLTERL-EDSKQFAVKAFSKEAAYNQ---ENGKEALINEIELMRAL-
3709_Tthe       -------------TLGIPLNDPDKRVAIKTIQKESVQG-----IPQHYLKREVDIIKSL-
4137_Tthe       -------------YLAERL-EDEKMFAVKAFSKEAAYAQ---EKGKEALLNEIDLMRAL-
4750_Tthe       -------------MLAQQTKPPFNKVAIKIIDKKSVKG-----TPSFYLKREVDIIKQL-
7304_Tthe       -------------YLVNHR-ETGKQLAIKAFLKEKLYQE---DKGSEAFFNEINLMKQI-
8030_Tthe       -----------------------------------FQQD---IARQKSLEKEIKIMQTVG
9801_Tthe       -------------EVVQLK-GTKQNRAMKKVDKHMLDSK----MQREEFIQEIDILKTL-
6435_Tthe       -------------YKVKRK-DTGELFAVKYLHKRKMKDI---DDSEAALDNELNILRQL-


10066_Tthe      KHK--N-IIQMEEIYQDHDQLVYIMEFLVGG-EVYSRLRQV---------------KRFS
10118_Tthe      NHP--G-VIKMYEVYENETHIFLVNELLKGG-ELFHKLKGH---------------GQFD
10195_Tthe      DHP--N-IIKLYEVYESESTIYLVTEYCEGG-ELFQYVVQ---------------NKRLQ
1090_Tthe       DHP--N-VIKLYEVFEGEHTFYFVMEIVEGT-SLYEEIKKH-------------AQNPYK
11510_Tthe      EHK--N-ILKGVEYFETDNAYKIVLEYYSGK-TLECRLQ---------------QIKSIK
11511_Tthe      NHE--K-VVKSYEFFQTESQYKLVLHYYEGG-SLEQKLE---------------KSKGFT
12415_Tthe      NND--H-LIRLYEVYETTNSIYFVVDLLNGG-ELLHRIREK---------------GSIN
13229_Tthe      DHP--S-LIKLYEVYEDETNIFLIYELLQGK-DLKSKLNEL---------------LCMD
14827_Tthe      KNK--N-ALKLIDIWESKNSYYLIMPVCYGG-SLLDRIAFTKKIEKNPELLMQSKANPID
15541_Tthe      TPVSIV-LEWLYEIYEDENNIYLITELFQGK-DMKSKLSDC---------------LILD
17681_Tthe      RHK--N-VMRLFEVFDADSSIKIVLELVEGG-QLFDLMKKN---------------PNLT
2256_Tthe       DHP--N-CIKLIATYEDNNGYYILTELLDSEKSLQGELTKFQ-------------NPQFG
23204_Tthe      DHP--N-IIKFQETYIDKKNIYIVMEYCTGG-NLSQK--------------------QFS
23205_Tthe      DHP--N-IIKFIETYIDKKNIYIVMEYCSGG-SLLEW--------------------TFK
23956_Tthe      SHP--N-IIKAYEYYKDSINYYFIFEFVDSG-SLIDRIIEC---------------DFFS
2623_Tthe       THP--N-IIQLFELYQDEQNYYLITEYCSGG-ELFEKIRQ---------------MEQFS
27560_Tthe      DNV--NGCLKLIGVYETDSSVNLILEYIKGG-ELVKKIKLK-------------DKQNFT
27680_Tthe      NHK--N-IIRLHEVFETENSLYMILDLLEGG-QLYDKIKAK---------------YKFT
3709_Tthe       DHP--N-ICKFLETYMDKENIYLVMEYCAGG-TLKELIYSQ----------------NNN
4137_Tthe       DHP--N-IMKLHEVFETENSLYFILDLLEGG-QLYDKMKSK---------------HRYT
4750_Tthe       DHP--N-ICRFLETYMDKDHIYLVMEYLSGG-TLRDKFINK---------------EELT
7304_Tthe       NHP--H-LLKLYEVWESMHSFYYVIELANGG-SLMDRISLAKRAKKKGLEK-EKDSGAFT
8030_Tthe       SHP--N-LLEFIGSYEGENTYYVAMGLIEGN-SLYNEIKKRKD-------------EKFP
9801_Tthe       DHP--N-ILKIYEFYEDNRYLYIITELCNGR-ELFDVIVED--------------DTCFT
6435_Tthe       DHP--N-CLKLVACFQDTNGYYILTELLDESKSLSQEIAKYK-------------NPQFS
                              :                  :

10066_Tthe      EEVAAEILKNLT------------------------------EGLLHIHNKKIVHRDLKL
10118_Tthe      EVYVAQLMTTLL------------------------------DSIHYISQRNILHRDIKP
10195_Tthe      EKDAALIMRQLF------------------------------SAVSYIHDNGVIHRDLKP
1090_Tthe       DEEVRDIMSMLI------------------------------DGIAYCASKNIMHRDIKP
11510_Tthe      LADACFIMQQIL------------------------------QGLQYIHSLNIMHRDLKP
11511_Tthe      LFQICDMMRQIL------------------------------QGFSYLHQNNIMHRDLKP
12415_Tthe      EKELRVLIRNLI------------------------------LALEHLHQKNIMHRDLKP
13229_Tthe      EKSVSDFIWKLL------------------------------HGLHHMHSRNIVHRDIRL
14827_Tthe      SLFIKSFMKQML------------------------------EALLNLKQQGILHRDLKP
15541_Tthe      EKTISEIMWRLL------------------------------QGLHHMHSKGIFHRDIKL
17681_Tthe      WFEIGLIMKQILSVNLQSFFPKNIGILSTSSINQFIIFVLQKKGLEALHSQNIMHRDLKP
2256_Tthe       YQVVRHILKQLI------------------------------KGIEYVHSLGIMHRDLKP
23204_Tthe      EQEVLNIMKKLL--------------------------------------------DLKL
23205_Tthe      EGDVLDVMKKLF------------------------------YAVNYMHSRNVIHRDLKL
23956_Tthe      EKLVKTVAKQVL------------------------------EVLAYIHNRHIVHRDITL
2623_Tthe       ERE------------------------------------------VYCHSLGIVHRDLKP
27560_Tthe      IENMRQLMQNIL------------------------------IALAHIHQRKIIHRDLKP
27680_Tthe      VEESKYIMKGLL------------------------------EGIAEMHAKNIMHRDLKP
3709_Tthe       EFAVAKIMQKLF------------------------------WAVNYMHNNNIVHRDLKL
4137_Tthe       SEEIKDILRGLL------------------------------EGCAHMHQKRIMHRDLKP
4750_Tthe       EYQISQVMQKLF------------------------------YAINYLHTRNIVHRDLKL
7304_Tthe       ENEIRSYIKQLT------------------------------SGLLHLKERKIMHRDIKP
8030_Tthe       IQKIKSFIQQII------------------------------SGVLHFQKYGVMHRDLKP
9801_Tthe       EQQTMKIMQQSL------------------------------SALQYAHSKCYAHRDIKP
6435_Tthe       YKMIKHILGQLI------------------------------KGLEYVHSKGIMHRDLKP
                                                                        *:

10066_Tthe      ENILFVNK------------------------TDNDCKLIDFGFAEKINYE---------
10118_Tthe      ENLILRSKN-----------------------NDTDLCLADFGLADYYDPK---------
10195_Tthe      ENFLLKKKS-----------------------DPTTIKMIDFGISKKFKKG---------
1090_Tthe       ENLLFGKVG-----------------------NQKILKIVDFGLGTYADEN---------
11510_Tthe      ENILLKDP------------------------NSFEIVIADIGFAQDLY-----------
11511_Tthe      DNILFFDK------------------------ESFDVVISDMGLSQDVN-----------
12415_Tthe      ENLLLKSKQ-----------------------SDSEIVVADFGLATRIDIP---------
13229_Tthe      DNIFFRAPN-----------------------NYSDVCISNFFLADFADQNRCVGQSYCY
14827_Tthe      DNILLCSPN-----------------------Q-VEPMIIDFGLATFQDVE---------
15541_Tthe      ENIQFRNSQ-----------------------NITDVCLTNFYMADFVDPK---------
17681_Tthe      ENILMRSKE------------------------SLDLVIGDFGLAQKADAK---------
2256_Tthe       QNIMFANSDS---------------------SSLSNLKIIDFGLAQFINDP---------
23204_Tthe      ENILYERDS-----------------------PDSEIKIIDFGLSKQVPKE---------
23205_Tthe      ENILFESES-----------------------QNSDIKIIDFGLAKKVGDD---------
23956_Tthe      KNILMNSFSK---------------------QQDLQIKIIDWGNATNIQGN---------
2623_Tthe       ENLLFDSNK-----------------------PNANLKVIDFGTSRRFDSS---------
27560_Tthe      DNILIEDDI-----------------------NSTKIKIADFGLATYDSTV---------
27680_Tthe      ENLIFKTAD------------------------SLDLAIVDLGLATRADIE---------
3709_Tthe       ENVIFSTTN----------------------PATSDIKIIDFGLSKKVHDK---------
4137_Tthe       ENVLFKDPQ------------------------GKQIVIADLGLATRCDLP---------
4750_Tthe       ENVVYTSTD-----------------------ENAEIKIIDFGLSKKLNVR---------
7304_Tthe       DNILLRKVPVFQNLKTPKSQHLSANTIQQPKQYKFEAIIVDFGLGTQQDIK---------
8030_Tthe       ENIMFKRKE-----------------------NLDELVIVDFGLAEFENEP---------
9801_Tthe       ENIMIDIE-------------------------TQKIKIIDWGTSTSFNG----------
6435_Tthe       QNIMFTISQS---------------------GALSQLKLIDFGLAQIIKSQ---------
                .*.                                   : :   .

10066_Tthe      ----KLESRAGTPGFL-------------------------PPELFKL------GPYTEK
10118_Tthe      --GGYMFQRCGTPGYV-------------------------APEVLAD------KIYDFK
10195_Tthe      ---EVLRQQSGTPYYI-------------------------APEVIE-------GQYSEQ
1090_Tthe       ---PYIFPKCGTPGFV-------------------------APEIANLVD--KAQPYSTV
11510_Tthe      --QDFVLPKCGSPGYI-------------------------APEVLNSRD---GKDCGVK
11511_Tthe      --ENFVFKKCGTPGYV-------------------------APEILNSIT---GTDYGVK
12415_Tthe      ---NILFKRCGTPGFV-------------------------APEVLLYKE--GDPFYTTQ
13229_Tthe      IPTKQNYKKYGTAGYL-------------------------APEVLKN------KQYDCK
14827_Tthe      ---NYIYPKCGTPGYV-------------------------APEIINMRD--KSQRYDSQ
15541_Tthe      --GKQTYKKCGTAGFI-------------------------APEIFKS------KHYDQK
17681_Tthe      ---KYLYLKCGTPGYV-------------------------APEVINLKE--EQTQYDTQ
2256_Tthe       ---NYIYVHVGTPGYV-------------------------APEILANES--EKHRYTEK
23204_Tthe      -QKARRHSIVGSETYMA-------------------------PEVLSS------KNYDKS
23205_Tthe      -DR--RHTMVGSVAYMV----INIKRLEMNK----QLLLQNTPEVMFN------KSYNKS
23956_Tthe      -E--NLKQITGELHFR-------------------------APEVLS-------QSYSYG
2623_Tthe       ---KKMTKRLGTPYYI-------------------------APEVLQ-------RSYDQK
27560_Tthe      -LNDFLFKKCGTPGFL-------------------------APEVLSNKD--THKLYDHK
27680_Tthe      ---EFMFVRCGTPGFV-------------------------APEVINIKD--LKTKYDVI
3709_Tthe       --QKRRHTKVGSFNY-------------------------MGKQTTKQ------ASK---
4137_Tthe       ---EYLFVRCGTPGFV-------------------------APEVVNIKN--LNTTYDPI
4750_Tthe       -SSRKRHTKVGSAYYMELGGIFNFKLIKLARRFILFLNIYKAPEVLLH------EKYERE
7304_Tthe       ---EYLFPKCGTPGYV-------------------------APEIINLKGDLTKARYTTQ
8030_Tthe       ---QYLFSKCGTPGYV-------------------------APEVANYKEE-LQNRYTTK
9801_Tthe       ---EKIKQLVGSAYYI-------------------------APEILKR------KGYDEK
6435_Tthe       ---KYIYVHVGTPGFV-------------------------APEILANES--ENHRYDEK
                          *   :                            :

10066_Tthe      GDIFSLGVILYCL---------VSGCSPFKGKTYKDVLENNRRCAISYDQPV-WNKISDE
10118_Tthe      VDTFSAGVIMFIL---------LTGSSPFKGKSYDEIVIKNYNCTIDFNYNEMGKYLSAE
10195_Tthe      VDNWALGVILYIL---------LSGTPPFYGKNAQEIFYSIRKCNYNLNLKA-FLECSNE
1090_Tthe       CDMFSVGVIFHIL---------LTGEAVFPGKKFNEVLKKNKLCEIDLEKKE-YENLSDP
11510_Tthe      TDMFSCGLLFYRL---------VAGKPLFSGKTVEQTLIENKKFKIDLSSSQ-IAQYPLQ
11511_Tthe      SDIFSCGCLFYRL---------VMGQPLFEGKSHVEVLEENRKCKIDLSSTE-FKKLPQQ
12415_Tthe      CDIFSAGIIFYLL---------LVGKQPFQGKDYKQILRANKACEIRYDLPE-FEKISNA
13229_Tthe      VDIFSLGIIFYFF---------VFGRMPFEGKDAEETLKLNEKCEIDFSQQPFFGKFTSS
14827_Tthe      CDVFSLGAIFYFL---------LSLKPLFLGKVTKETIEMNKRCQIDFDCKE-LQNVDLN
15541_Tthe      IDIFSLGIVFYIL---------MFGKMPFDAPTVDQILQLNEQCEIDFTSNDCAIKCTSS
17681_Tthe      CDIFSAGAIFYKL---------CVHKPLFQGVTHAEVLQENKSVNFNLNCQD-VKDLPPL
2256_Tthe       CDLFSIGVVFHILQVISNKKKILTGRSVFPGKKFSQVLQSNKECKIDLRGPK-YDELNKD
23204_Tthe      CDVWSLGVIMYRL---------LSGELPFKQRQ------QILDGLLIFKSPI-WSSVSRD
23205_Tthe      CDVWSLGIIMYRL---------ICGQLPFKSQQ------QIHDAKLYFDNPI-WKTISKE
23956_Tthe      CDIWSLGVVIYTL---------IEGEVPFVKKTEAEIIQSIKNESLSFSSSN-WENVTIE
2623_Tthe       CDVWSCGVILYIL---------LCGYPPFNGRTEEQILKSVAEDDFTFEDTE-WSCISKE
27560_Tthe      VDVFSAGVIFYIL---------LCGQQPFKGSNHRQVVEQNKKCEIDFQILDSNQKIPQA
27680_Tthe      CDIFSLGLIFHIL---------LLGRTPFNGKNYNEILAQNRASNISFEGTE-YLKLPLP
3709_Tthe       ------------------------------------------------------------
4137_Tthe       CDLFSIGLMFHIL---------LIGKSPFDGKTYNDILSQNRACNIKFDSVE-YLKLPLQ
4750_Tthe       CDMWSLGVMMYFL---------LSRELPFEDLD------QIEQGKFNFDAPV-WNYVSDE
7304_Tthe       CDMFSIGATFYFM---------LSLKPLFLGQTTRETIELNKKCEVNYNIPE-LKDCDKN
8030_Tthe       CDMFSVGVILHTL---------LYHSSVFYGKKFNDVLLKNKECKIDFNSKL-YENTSER
9801_Tthe       VDIWSLGIVFYLL---------ITGTTPYNAETTTEIFEEIKKYKLSFEDPL-WEKFSTE
6435_Tthe       CDLFSIGVIFHIL---------LTGKTVFPGNKFSQVLEKNKLCQIQLSGAR-YEQISQE


10066_Tthe      CK-----HLIRRMVEVDPKKRYACNDIL---KSKWMNK-YFPNSPQHSQ-KSLT------
10118_Tthe      CF-----DLLQKLLKKDPLERYSAIQAL---NHPWFAK-MKAATPTTQQKS-SVV-S---
10195_Tthe      VR-----DLISRLLVKNPKKRLCDIDCY---NHPWVQQ-QVSRENQNLIISSDSL-A---
1090_Tthe       AK-----DLLRRMLEKDPQKRITAAEAL---QHHYFTQ-QKLKKAPST---DDLF-G--M
11510_Tthe      IQ-----KIIKGMLQINPVKRISAEQAL---LSGFYNL-EGDDD----------------
11511_Tthe      NSMQNNNNIFAKTYKINVEYFID--QILLNSQTPFFLAIKSNNQ-IS-------------
12415_Tthe      AK-----DLLKKMLDARPEHRFSATQCL---QHPFLHL-DGEYQPGDIS-CGNLG-S--Y
13229_Tthe      AL-----DLMKKMLDKDPKMRGDAATLL---NHTWFVN-MRNKGDDGKSRNGNNY-C---
14827_Tthe      TK-----DLLKKLLKVNPSERITPEQAL---QHPYFGD-KFDEDD-IPDDPETNI-----
15541_Tthe      AI-----DLLKKMLNKDPSQRANAFQLI---NHTWFIN-MKNRGEDGRMRN--NF-Y---
17681_Tthe      AQ-----DLLKQLLKCDPKQRITATEAL---KHKFFKD-VTEKEGERHK-S-PFK-G---
2256_Tthe       AI-----DLLGKLLEPNPLKRPSATDAL---LHKFFFP-DAQKEANKVSSAANLD-Q--T
23204_Tthe      AF-----DLLKKMVNVYPQYRITIDQAL---KHSWFQQ-RRSTVQISQL-IQLQP-G--H
23205_Tthe      GK-----DLIRRMIVYNPKIRITIQDAL---KHKWFSL-RNTTLKLTQN-----------
23956_Tthe      CK-----QIVQSMLQKDHKKRPKAVELL---ENKWFSD-NETDKEITK--NKFV------
2623_Tthe       AK-----DLISRMLKKNPEERITAQQAY---DDVWVQK-NASKNPLNTK----VL-T---
27560_Tthe      AK-----ILVKQMLAKDPINRPTSQECL---NSPFFKE-NIINNSLHFDL----H-N--Y
27680_Tthe      AY-----DLLKKMLDNDPKTRITAKKAL---QHQFFTQ-KKGEQMEIES-P-QLT-----
3709_Tthe       -------------------------LAS---MHSCWKQ-T--------------------
4137_Tthe       TY-----DLLKKMLEKDPKNRINAADAL---KHPFFDS-NNQVKPIQQS-NSQTL-----
4750_Tthe       AK-----DMIRNILLVNTKKRLKLSQAL---DHKWFQM-MNKLKQNNEK-PKNLP-V--P
7304_Tthe       AI-----DLMKKMLEKDPTLRIDPKSAL---KHPYFKN-LDSNFEEDLVVPEDTP-T--Q
8030_Tthe       TM-----NFMKGLLEKDPIKRLSAQQAL---NHEFFYD-IDEDETQQIRKKAGSWNISAP
9801_Tthe       CK-----DLLSKMLNPQPNKRISAQQAL---KHPWFET-QPNQVPQNLLK--TKL-N---
6435_Tthe       AL-----DLLGKLLQKDPRRRISAKDAL---QHPFFSE-KGSEFDKMPSCMETVQ-G--V


10066_Tthe      ----------------------------------------------------TNKTGKTN
10118_Tthe      -----------------------------------S------QTSL--------------
10195_Tthe      -----------------------------------G------LKKIV-E---LKNI-KKT
1090_Tthe       -----------------------------------N------KEDLP-------AI-REK
11510_Tthe      ------------------------------------------------------------
11511_Tthe      ----------------------------------KF------ISKIK-------NF-FQE
12415_Tthe      -----------------------------------E------VEFLA-------NV--RN
13229_Tthe      -----------------------------------G------FPTLS-------TV-QEF
14827_Tthe      ------------------------------------------DKVLQ-------RF-NYG
15541_Tthe      -----------------------------------G------MPTLS-------TI-QER
17681_Tthe      -----------------------------------D------VEKMR-------HL-IKQ
2256_Tthe       ------------------------------------------ANSVSTN---VTNK-DKE
23204_Tthe      -----------------------------------LL----VLNKFQ-L---YDHF-SQF
23205_Tthe      ------------------------------------------FNQLF-T---ISFM-KQK
23956_Tthe      ----------------------------------------------------ENMT-QQA
2623_Tthe       -----------------------------------N------LGSFH-S---KNKL-RAS
27560_Tthe      --ENQKLKIDSLDKNSQNDLYWVNPVWKGQTNTVQT------VTKLS-------SI----
27680_Tthe      -----------------------------------E------AQKMK-------QL-QEE
3709_Tthe       -------------------------------------SASQLVSKQA-QITF--------
4137_Tthe       -----------------------------------N------DSTKD-------EI-KED
4750_Tthe       -----------------------------------HRSYTQLVEKLV-QFRMENQF-RRE
7304_Tthe       -----------------------------------I------ESVIK-------KF-QSE
8030_Tthe       KLE--------------------------------Q------DEIVV-------NV----
9801_Tthe       -----------------------------------S------MKTFT-Y---QSKL-QMA
6435_Tthe       -----------------------------------Q------MTKLKDE---ITNL-PKR


10066_Tthe      RKK---H-------------------------------------------------M---
10118_Tthe      --E---G-----------------------------------------D-----------
10195_Tthe      ILI---Y-------------------------------------------------M---
1090_Tthe       QTS---M-----------------------------------------------------
11510_Tthe      QYF-----------------------------------------------------CNNQ
11511_Tthe      QSF-----------------------------------------------------IKEK
12415_Tthe      KQL---D-----------------------------------------------------
13229_Tthe      T-E---G-----------------------------------------PELLSGCS----
14827_Tthe      RPFDMQK-----------------------------------------------------
15541_Tthe      S-----------------------------------------------------------
17681_Tthe      EKK---R-----------------------------------------------------
2256_Tthe       -ME---TPLKFG-----------GKL-AKGFHNLNKITSVKDIDNIPFN-----------
23204_Tthe      KKE---M-------------------------------------------------Y---
23205_Tthe      VIS---I-------------------------------------------------F---
23956_Tthe      TIS---Y-------------------------------------------------I---
2623_Tthe       ILT---F-------------------------------------------------I---
27560_Tthe      --Y-------------------------------------------------------LQ
27680_Tthe      HRQ---R-----------------------------------------------------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       DVT---S-----------------------------------------------------
4750_Tthe       VL----M-------------------------------------------------I---
7304_Tthe       QYQ---L--------------------------------------------VQLQYITFD
8030_Tthe       ---QQTE-----------------------------------------------------
9801_Tthe       TIQ---Y-------------------------------------------------V---
6435_Tthe       PMK---T-LSSLQDYDQPNGVSPTTIRANLFQQLNSLKSMKDIDAT--N-----------


10066_Tthe      ---------------------------------------------RES-----------S
10118_Tthe      -----------------------------------------------------------Q
10195_Tthe      ----------------------------------------------AS-----------Q
1090_Tthe       ---------------------------------------------FTK--P---L-----
11510_Tthe      INSLSQKSF---------------------------------------------------
11511_Tthe      IQELKQSIQNQIV---KIL--------------------------TNK--G---------
12415_Tthe      ---------------------------------------------SQE--M---------
13229_Tthe      -------------------------------------------------------Q-DSR
14827_Tthe      ---------------------------------------------INNHST---------
15541_Tthe      ----------------------------------------------------------SE
17681_Tthe      ---------------------------------------------NEE--M---------
2256_Tthe       FDDIQQK--------------------------------------IQN--QISMY----T
23204_Tthe      ---------------------------------------------VKR-----------Y
23205_Tthe      ---------------------------------------------IKN-----------F
23956_Tthe      ---------------------------------------------ATH-----------Q
2623_Tthe       ----------------------------------------------AT-----------H
27560_Tthe      INDVRKRNKSNFAPINVHAEESKDDDSGIASSVREKRSASADCDFRNK--Y---------
27680_Tthe      ---------------------------------------------LGS--T---------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       ---------------------------------------------RNS--S---------
4750_Tthe       ---------------------------------------------MVK-----------R
7304_Tthe       MSRINSLINSSLRQQ------------------------------MKQ--Q---SQEQST
8030_Tthe       ---------------------------------------------QQSPG----------
9801_Tthe       ----------------------------------------------AS-----------H
6435_Tthe       ------E--------------------------------------TSY--SLQTE-----


10066_Tthe      LSKNSLLDD-------------------------D-------L---------------KK
10118_Tthe      IVR-IAPKDNLQLKSKT-----------------P-------L---------------M-
10195_Tthe      I-Q-DSDLD-------------------------V-------L---------------K-
1090_Tthe       -------R-------I------------------P-------Y---------------L-
11510_Tthe      ------------------------------------------------------------
11511_Tthe      -ML-NNSLNG-----IN-------------------------T--------------P--
12415_Tthe      -IG-SLALHS-----TG-----------------K-------L--------------PI-
13229_Tthe      ILR-NYDLKELRFPN-------------------------------------------Y-
14827_Tthe      -YS-KMNTKT-----DQSLFSFNYIDYAPFQKKES-------L---------------L-
15541_Tthe      IVE-VSSR----------------------------------------------------
17681_Tthe      -PE-NSPLKM-----KQ-----------------P-------L---------------I-
2256_Tthe       ICK-QKDEAQ-----KQ-----------------SLYKLAQEL---------------V-
23204_Tthe      VS--KDQEL-------------------------N-------Y---------------RK
23205_Tthe      LS--KKKEL-------------------------H-------M---------------RN
23956_Tthe      IS--QFERS-------------------------S-------V---------------AQ
2623_Tthe       IVS-QQEKE-------------------------E-------L---------------L-
27560_Tthe      -LQ-NQSLHI-----TV-------------------------LKKQKQGDEQTNNDNP--
27680_Tthe      -NK-DSPMPS-----PQ-------------------------I-----------------
3709_Tthe       -------EI-------------------------L-------S---------------FN
4137_Tthe       -LM-NSPINS-----PN-------------------------I-----------------
4750_Tthe       IS--PNENI-------------------------T-------P---------------KN
7304_Tthe       CLS-NTSQKS-----L------------------Q-------M---------------L-
8030_Tthe       -LN-NNNNKQ-----AGSLRKRACTSQIQQQLKNN-------L-----------------
9801_Tthe       LLS-QQEKE-------------------------E-------L---------------S-
6435_Tthe       ----------------------------------ALYKFTKDL---------------I-


10066_Tthe      SIGSKASGESVEFNT---------STI--------------I-------------NMHSD
10118_Tthe      ---NS--------KW---------SEP--QE-QQ--SPETWK-------------KQQQQ
10195_Tthe      ------------------------QIF--------------V-------------SMDKD
1090_Tthe       ---S---------KD---------TAS--------------G------------------
11510_Tthe      ---K--------------------SSF--------------N-------------S--KQ
11511_Tthe      ---K--------------------GSC--------------S-------------S--MS
12415_Tthe      ---NG--------NV---------NTI--------------G-------------SLSTY
13229_Tthe      ---SG--------EF---------SNI--KNDEDIPGSNYIY-------------NVVKD
14827_Tthe      ---MG--------ASLVMKQPITIKNPG-------------G-------------RQI--
15541_Tthe      --------------------------------QD--------------------------
17681_Tthe      ---TG--------KT---------KPI--------------Q-------------PH---
2256_Tthe       ------------------------DLF--------------I-------------ILEEN
23204_Tthe      -------------------------LF--------------K-------------SIDSE
23205_Tthe      -------------------------LF--------------R-------------TLDEE
23956_Tthe      -------------------------LF--------------Q-------------KLDTN
2623_Tthe       ------------------------KTF--------------K-------------GLDQN
27560_Tthe      ---E--------------------ASI--------------DNNIDCIEENFDVSG--YD
27680_Tthe      ----M--------PT---------RAM--------------K-------------N-MQD
3709_Tthe       -------------------------LF--------------F-------------DNQKP
4137_Tthe       ----G--------PR---------KIN--------------Q-------------G-PLN
4750_Tthe       -------------------------LF--------------R-------------NIDKD
7304_Tthe       ---N---------TL---------SNNNNSN-QM--QPPT-S-N-----------MQYLS
8030_Tthe       ---------------------LNIPSLG-------------S-------------GQTQN
9801_Tthe       ------------------------DLF--------------I-------------HLDTN
6435_Tthe       ------------------------VLL--------------E-------------DIENN


10066_Tthe      N------P--K-------------------------------------------------
10118_Tthe      G------R-NSV-SEY----------I------DSP------------------------
10195_Tthe      G------N--G-------------------------------------------------
1090_Tthe       ----------ST-DDN----------L---------------------------------
11510_Tthe      S------T--S---SQ----------I---------Q-----------------------
11511_Tthe      S------N--N---SL----------P---------N-----------------------
12415_Tthe      S------N--SS-ITN----------L------ERKN-----------------------
13229_Tthe      G------SLIYE-DEF----------M------KET------------------------
14827_Tthe      -----------SL---ENV-------VEQA---N--------------------------
15541_Tthe      ------------------------------------------------------------
17681_Tthe      ----------SS------------------------------------------------
2256_Tthe       Q------T--DD-LSF----------F------ASPLKIRGGLRNSMA--------DGSL
23204_Tthe      N------K--G-------------------------------------------------
23205_Tthe      Q------K--G-------------------------------------------------
23956_Tthe      H------T--G-------------------------------------------------
2623_Tthe       G------D--G-------------------------------------------------
27560_Tthe      L------K--N---SL--DQQEQNKNE---------D-----------------------
27680_Tthe      D------H--G---S-----------F------KMPN-----------------------
3709_Tthe       Q-----------------------------------------------------------
4137_Tthe       Q------D--SC-LT-----------F------KMAN-----------------------
4750_Tthe       Q------N--G-------------------------------------------------
7304_Tthe       N------T--SM-VSN----------L------NSPN-----------------------
8030_Tthe       N------E--AAINSFNNA-------LSQEQIST--------------------------
9801_Tthe       K------D--G-------------------------------------------------
6435_Tthe       KEFLHATT--VE-EDY----------T------DSPMKLQQK--NKFFNPPISEQEENQR


10066_Tthe      ------------------------------------------------------------
10118_Tthe      -----MS-----------------------------------------------------
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------------------
11510_Tthe      --T--------------F------------------------------------------
11511_Tthe      --T--------------P------------------------------------------
12415_Tthe      --T---------------------------------------------------------
13229_Tthe      -----VHDKMITLNKLQFMKVP--------------------------------------
14827_Tthe      ------------------------------------------------------------
15541_Tthe      ------------------------------------------------------------
17681_Tthe      ------------------------------------------------------------
2256_Tthe       LQK--------------FG-----------------------------------------
23204_Tthe      ------------------------------------------------------------
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      --Q--------------F---KQQNSDYNNNQLNLKASQFKKSQFLDSNRDEYKPSMKSS
27680_Tthe      --T---------------------------------------------------------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       --T---------------------------------------------------------
4750_Tthe       ------------------------------------------------------------
7304_Tthe       --MAAMQ-----------------------------------------------------
8030_Tthe       ------------------------------------------------------------
9801_Tthe       ------------------------------------------------------------
6435_Tthe       IKI--------------IT-----------------------------------------


10066_Tthe      ------------------------------------------------------------
10118_Tthe      -----------------------RQAQDS----------PQI-------KTPGGSQY-SQ
10195_Tthe      ------------------------------------------------------------
1090_Tthe       ------------------------------------------------N-----------
11510_Tthe      ------------------------------------------------------------
11511_Tthe      ------------------------------------------------------------
12415_Tthe      ------------------------------------------------SSGPGASIFNKG
13229_Tthe      ----------------------SKYRHDSFHYHLQSRLGINI-------QEFYNMP--QQ
14827_Tthe      -------------------------------------------------------EYK--
15541_Tthe      --------------------------------------------------LFYR------
17681_Tthe      -------------------------------------------------------VTKRG
2256_Tthe       ------------------------------------------------------------
23204_Tthe      ------------------------------------------------------------
23205_Tthe      ------------------------------------------------------------
23956_Tthe      ------------------------------------------------------------
2623_Tthe       ------------------------------------------------------------
27560_Tthe      GWESIENEPQINKQGLNQNRLENKYSLKPFQNM--EAIN------VQY------------
27680_Tthe      ------------------------------------------------------PVLT-G
3709_Tthe       ------------------------------------------------------------
4137_Tthe       ------------------------------------------------------PVLN-G
4750_Tthe       ------------------------------------------------------------
7304_Tthe       ------------------------ESTH-----------SDYESRSQYS-----------
8030_Tthe       -------------------------------------------------------SFHHN
9801_Tthe       ------------------------------------------------------------
6435_Tthe       ------------------------------------------------------------


10066_Tthe      -SFY-RKSMRSLKSI---------------------------------------------
10118_Tthe      PFKKTPD--------S--------------------------------------------
10195_Tthe      -RIS-LDEL-----K---------------------------------------------
1090_Tthe       SFVT-RDPM-----F---------------------------------------------
11510_Tthe      ---------------------------------------------------AS-------
11511_Tthe      ---------------------------------------------------TS-------
12415_Tthe      RSDS-IDQN-----M---------------------------------------------
13229_Tthe      TLQNVNSSN-----ST--------------------------------------------
14827_Tthe      ------------------------------------------------------------
15541_Tthe      -----RGEN-----GP--------------------------------------------
17681_Tthe      SFIQ-VQSS-----S---------------------------------------------
2256_Tthe       SFDQ-DDES-----NP--------------------------------------------
23204_Tthe      -IMT-KQQI-----D---------------------------------------------
23205_Tthe      -YMT-QEDL-----Q---------------------------------------------
23956_Tthe      -SLS-KEEI-----A---------------------------------------------
2623_Tthe       -LLE-KHEL-----V---------------------------------------------
27560_Tthe      ------------------------------------------------PTFMS-------
27680_Tthe      RTEA--------------------------------------------------------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       RVTD--------------------------------------------------------
4750_Tthe       -VIT-ADEL-----R---------------------------------------------
7304_Tthe       NFKH-KESI-----NDSELNYVNKNQNVYGYISKQFISQSSFENDMRSPSFAASETSICR
8030_Tthe       IYNM-FQSN-----M---------------------------------------------
9801_Tthe       -KLS-KEEI-----F---------------------------------------------
6435_Tthe       EIKK-NKEN-----SL--------------------------------------------


10066_Tthe      -------------K------------------SLKSHFSHK---T----V---KS-----
10118_Tthe      -------------N------------------GS----------SK-IKQ---ET-----
10195_Tthe      -------------G------------------G-LQLFKEKC--NL-DFQ---ES-----
1090_Tthe       -------------A------------------GQ----------NQ-VRQ---RA-----
11510_Tthe      -------------P------------------KQ----------NS--------------
11511_Tthe      -------------N------------------AT----------NK--------------
12415_Tthe      ---------------------------------T----------GTPSSR---KS-----
13229_Tthe      -------------S------------------NT----------NQ-VGQ---NL-----
14827_Tthe      -----------------------------------------------------YK-----
15541_Tthe      -------------N------------------NS----------SR-I------------
17681_Tthe      ---------------------------------N----------NS-SRR---SS-----
2256_Tthe       -------------QKSNVILQEVKEEEEFPQANN----------NQ-NQQ---QDQKNEN
23204_Tthe      -------------E------------------TL-QKLGIDKQQ----------Q-----
23205_Tthe      -------------D------------------IM-EKVGIQANEQ----T---KS-----
23956_Tthe      -------------Q------------------VCKLQFGQQ---L----T---ES-----
2623_Tthe       -------------E------------------GYLQVMKDRA--Q----A---EE-----
27560_Tthe      -------------Q------------------IS----------QK--------------
27680_Tthe      ------------------------------------------------I-----------
3709_Tthe       ------------------------------------------------------------
4137_Tthe       -----------------------------------------------SLH---DS-----
4750_Tthe       -------------L------------------CL-YELGYKDIQN----V---DQ-----
7304_Tthe       QESLTSNFSLKMKA------------------HQ----------NT-NKQ---KD-----
8030_Tthe       ---------------------------------T----------NS-VAK---GN-----
9801_Tthe       -------------N------------------GYKNLY-GEV--E----A---RQ-----
6435_Tthe       -------------INTIKVPERIEE----EEEEN----------NQ-VENQPESDQKNEE


10066_Tthe      ----HSS---YSST------------DSL-----------------DAP-SSN----QDL
10118_Tthe      -----------PV-------------IKM-----------------Q-----SVPECMDE
10195_Tthe      ----E-V---KQIF------------QAM-----------------DFDNSGQ----IDY
1090_Tthe       ----D-S---NKMY------------YTI-----------------G-----S----LDR
11510_Tthe      ----D-R---RNLF------------SSS-----------------------A----ITQ
11511_Tthe      ----D-K---QDVR------------KSQ-----------------------Y----CKQ
12415_Tthe      ----N-N---NSLF------------KAT-----------------------L----IKN
13229_Tthe      --------------------------TSQ-----------------T-----QTQNDIAQ
14827_Tthe      ----N-L---QSMV------------KSE---SSVKSKL---LYKSP-----T----LDQ
15541_Tthe      ----------------------------------------------Y-----EENN----
17681_Tthe      ----K-N---SNLG------------LGS-----------------------N----QKK
2256_Tthe       G-----------------------------GRA-------------A-----M-------
23204_Tthe      ----E-V---NKTAQN---NSQNQI---N-----------------NVQVDDT----VEY
23205_Tthe      ----F-C---NNFLRQLTNNSKEEQ---Q-----------------QFQHADI----LQY
23956_Tthe      ----Q-I---NDIF------------EEL-----------------DIDKSGN----ISY
2623_Tthe       ----F-V---NKIF------------DEI-----------------DVNSSGK----VDC
27560_Tthe      ----E-R---QDVR------------LSN-----------------------I----ISD
27680_Tthe      ------S---NDGF------------DSP-----------------S------------V
3709_Tthe       ------------------------------------------------------------
4137_Tthe       ----Q-N---NDSF------------QCL-----------------D-----N----LKK
4750_Tthe       ----L-L---HKICGN---NKQENLSLKQ-----------------GVQETNY----INY
7304_Tthe       ----Q-N---NQVR------------YRA-----------------Q-----SVEDSLDP
8030_Tthe       ----N-Q---QSDG------------KSN---IMESAKLSIELGSSP-----Y----MQP
9801_Tthe       ----I-S---EKIF------------SEV-----------------DVDNNGS----IDY
6435_Tthe       LTDQD-RQKIRDLK------------KNLCINT-------------K-----M----TEK


10066_Tthe      N------------------K--A------------------------LCDNYKGK-NFDN
10118_Tthe      ---YD--IDPSSLE-----------------------------------D----------
10195_Tthe      S------------------EFIA------------------------TFLANPEF-QTDK
1090_Tthe       Q---G--------VEPN--QVSG------------------------QKDSDKSK-FHA-
11510_Tthe      Y---N--SSVSPF----------------------------------NEISKAIIA----
11511_Tthe      T---S--LEVT------------------------------------EQQQKKHIQSKE-
12415_Tthe      S---Y--------H---TSQFGG------------------------NEERKGRDDEYE-
13229_Tthe      ---L---------Q-----------------------------------T----------
14827_Tthe      S---EY-------------EFLV------------------------DC-----------
15541_Tthe      ------------------------------------------------------------
17681_Tthe      A---S--------L---DSIEEG------------------------DEDQKKELGSGI-
2256_Tthe       --------------------------------RPAKLKIESLNHNEEEEEQ-KDIVTD--
23204_Tthe      S------------------EFLA------------------------GC