Protein (view, download) , Domain (view, download)
29569_Tthe       MATGGIEPACSKK-----------------------------------------------
13773_Tthe       MLEHLLESALIKLYQ-----GNFTDSKQIVQAISDILLDETLDDSQISLCNSKIFNSDLN
20618_Tthe       MSHIMQEIS--KLFEQFKKAKNQE-SERLA--------------------------ADLQ
20619_Tthe       MQEEKLLKKNTEVFGRLLRLGGQR------------------------------------
n8_Tthe          MQQGSQNL--QSR-----------------------------------------------
n29_Tthe         MRLNLNRNIYQKLKE---------------------------------------------
n73_Tthe         MSEENSIIL--KT-----------------------------------------------
n131_Tthe        MDRNSH----SRNGK---------------------------------------------
n502_Tthe        AYAFSLQSLQKKAVR---------------------------------------------
n508_Tthe        MDAISIV-IKDP------------------------------------------------
n545_Tthe        HFL-NNR-I---------------------------------------------------
n679_Tthe        MKKGPTEYIQHTLLDQL----------P--------------------------------
n737_Tthe        MAEDTQK-----------------------------------------------------
n858_Tthe        MAQFFNQK--QKE-----------------------------------------------
CC1G_04234_Ccin  MQAALNDLS---VQR---------------------------------------------
CC1G_13883_Ccin  MDCLEFNIH-QRILS---------------------------------------------
GK312_Glam       MTNAGFYRT---LWK---------------------------------------------


29569_Tthe       --------------------------------------------------------FLMF
13773_Tthe       LFTYLENNRTYKDNLQAQIRKGLFRTIAAYIKLRKLKVFEYIELICKNCMSLFKKEESNQ
20618_Tthe       Q-LYLKNNQYYDE-----IYHGLIK--------------------------LINSNDINE
20619_Tthe       ------------------------------------------------------------
n8_Tthe          --------------------------------------------------------DISQ
n29_Tthe         --------------------------------------------------------NSQK
n73_Tthe         --------------------------------------------------------KKPH
n131_Tthe        --------------------------------------------------------SPIS
n502_Tthe        --------------------------------------------------------K---
n508_Tthe        --------------------------------------------------------E---
n545_Tthe        ---------------------------------------------------------NP-
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        --------------------------------------------------------NEEE
CC1G_04234_Ccin  --------------------------------------------------------RN--
CC1G_13883_Ccin  --------------------------------------------------------ELAS
GK312_Glam       --------------------------------------------------------TGLF


29569_Tthe       DQ--FQ---------MLIYL-----------------EATIFNDNIGETTQ-----NRIN
13773_Tthe       AK--ETSLSP--IIKIIKCI-----DNSELL-EKIIDPKNTISAL-----L-----NE--
20618_Tthe       -K--YNSLIG--IEQISYVV-----QEDQY--LN-------LWSKF-NSLV-----FQ--
20619_Tthe       ------------------------------------------------------------
n8_Tthe          DK--YAVTCR--IEKFIICV----------------DPDSRQIYGL-NPQN-----ND--
n29_Tthe         SDNQI---TR--QDEIKFC--------------------QIIQG-S-LVGQ-----QL--
n73_Tthe         GI--LASVFC--CKCFKCCQ-----EIDQSL-L-TSNDRKKILNK---------------
n131_Tthe        SSNNL---GD--QKELNQH--------------------DYIFS-L-ERVQ-----QQ--
n502_Tthe        -KQIL---AS--IKRYIIIH-----HFIKKL-I-LYMKKKALESIV-NRRT-----NR--
n508_Tthe        -NNNL---GR-----------------------------HSVFD----------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -------------VKFKICC----------------------------------------
n737_Tthe        ---------------LLICV----------------DPKTKWFYTI-NTNT-----NE--
n858_Tthe        AQ--Y--------EKWLICV----------------DPKSKMFYTV-NSVT-----NE--
CC1G_04234_Ccin  ---------------------T----QS---F----------------------------
CC1G_13883_Ccin  KQDDT---PGQDSSKDLIISKVQTRDVSEVSAEGCPEPTTRVYMSA-SRVHCNIAFGE--
GK312_Glam       DTDML---KRQ----------VQEKDED---V----------------------------


29569_Tthe       QKIV-------------IGLSKDLLKSKEA---KASQQNFEQANRLN----------SIE
13773_Tthe       --I-------------------KFC--------KPTQKVKGSIWNLIGI-IFQFFTDQ--
20618_Tthe       --LL-------------EQ---TG----DEKVIKKSAEVYGRLLRLGGTRITNLLTD---
20619_Tthe       --------------------------------------------------VQNVLVG---
n8_Tthe          --LY-------------IF----------------------------------------L
n29_Tthe         --LSSNYDIMPFQLGLILW----------------------------------------K
n73_Tthe         ---------------------------------------------------------L--
n131_Tthe        --IPIPQNFPPKE-----------------------------------------------
n502_Tthe        --------V---------------------------------------------------
n508_Tthe        --------I---------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        --LR-------------IE----------------------------------------E
n858_Tthe        --LH-------------IE----------------------------------------T
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  --LV-------------VN----------------------------------------F
GK312_Glam       ------------------------------------------------------------


29569_Tthe       --------QSNQK--NRVQAKQEG-------------I---QGSGFLQ------------
13773_Tthe       -----------LE--DDLKA----------------EI---QTVCFKE------------
20618_Tthe       ----------QIQ--KPIH----WIFKN-SGDNKKFS----GLLVLKELLEQ----A--S
20619_Tthe       ----------YIS--NIIE----SLFLTSTKDNQKYA----SLLVLKELLEQ----S--P
n8_Tthe          --------DEKLK--NQIDYDGDR--------VQAEEM---QNVKFLDSLRE----Q--F
n29_Tthe         NLPNEFSSVL-DNLQNLI---------------GQGA----LTKYL--------------
n73_Tthe         -----------I------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        -SPSKL-T----LSNDMV---------------EKYM----PIRIYKDILER----LKHP
n508_Tthe        -------------KP---------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -----------------------------INDQKK------VL-----------------
n737_Tthe        --------DA-EQ--NVVM-----------------------------------------
n858_Tthe        --------DA-D----DIM-----------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  --------------------PAI----------QLGQSIESIMAALLDILRD----I--P
GK312_Glam       ---------------------------------QLWSS----AELLLDLIRSDRPRP--P


29569_Tthe       -------------------------VQQSLSVNRPS------------------------
13773_Tthe       -------------------------LQVQMASQKPEVSYVSGMFKSFRYSLKEIHLSNKE
20618_Tthe       FVTFK-------------------------------------------------------
20619_Tthe       FITFK-------------------------------------------------------
n8_Tthe          LEDNKIE------------------LSQQVSKNLNS------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------KNTSDPQL----
n131_Tthe        ------------------------------------------------------------
n502_Tthe        YKNL--------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -------------------------------------------------DLSEKHI----
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  FIDFDPSLSWHGAVLSEFVIAWGTHVRSR--LGVSGP-----------------------
GK312_Glam       FTKVSAE--------IFFDGSQSAEADEKPSIDVKGA-----------------------


29569_Tthe       ----------------------SS------------------------------------
13773_Tthe       LEDLYKMIKIGITEIKDVQILDDS------------------------------------
20618_Tthe       ------------------QFISNT------------------------------------
20619_Tthe       ------------------I-IANT------------------------------------
n8_Tthe          ----------------------IS------------------------------------
n29_Tthe         ----------------------ND------------------------------------
n73_Tthe         --------------------YDA-------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ---------------------ACE------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        --------------------W---------------------------------------
n679_Tthe        ------------------RYFFND------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  -----------------------A-SLFYDLCSTSTFFVDQVVDSIASST----------
GK312_Glam       -----------------------TLNLFFDILHQSSILTSSLVQYLTTKLLLNWSDVDTI


29569_Tthe       ---NNLMD--------QTAQI------HIQKQDSNSAKSSKS---SIS------------
13773_Tthe       ---KEIID--------KVLGLISHNNRDVKENAS---DCLESLMALLA------------
20618_Tthe       ---EDYRT--------NLWNLIKHKTTLLREAAL---SFFDVLLKQISLKEQDIQDREYN
20619_Tthe       ---ENFRS--------KIWSHIKSKNILVREAAL---SFFDQYMQHISLKEQEVQEKEYS
n8_Tthe          -------N--------H-------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ---HGL----------------SQ---NIKKKNSQISDPIQILIG---------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ---LLLAQQFQKQIQQE-------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ---EDGSS--------KLENLEAMV------------------TAQLVVNEKKIQPAQ-Q
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ---------------------------------------------------------AF-
GK312_Glam       SASLDPVG--------YVCLLLVYHSMVSSDSAL---VL--LIEKLITATIHSISNKRFN


29569_Tthe       -----YN--------------------SETNYLKMNAQPS---------------N----
13773_Tthe       ---------------------------IELDSSYKNHELS-------------FNYIIQK
20618_Tthe       T---FFTDICQSMNARQEEVVIGNISALKILVTYPNSEQF-------------NDQQFSQ
20619_Tthe       A---YYTDIESYLKQKEEEMIIGNIAVLKIIFSYPSQEQF-------------TDTQYSN
n8_Tthe          ----------------------------QTDVIKQNGQLS-------------TST----
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ---------------------------------L--------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ----------------------------QMESQKFGKEMS-------------LKTIQQN
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        T---L-------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  -------AVCQRVLHKCHEIIFSDLSPA--------------------------------
CC1G_13883_Ccin  -------------------IILTQLFPA--------------------------------
GK312_Glam       ETLGTFLVICRGTLVDIEELIIRHSISLQNLAQYERNLAFLSGMAHGYTYLQIESHKFAV


29569_Tthe       ------------------------------------------------------------
13773_Tthe       MS-FLINQER--QQIYTASITVIIKSIGI-------------------------------
20618_Tthe       MCMYVL-SKK--DE-NSNIQKTVIEALPA-------------------------------
20619_Tthe       MCKYVL-SKK--EHTYQSIQKIVIDTLPI-------------------------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         -----FDFESQSYPLL--------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        QH-QQIDQER--NDIS--------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ----------------------FID-----------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ----------------PSGPYSISNLSPL-------------------------------
CC1G_13883_Ccin  ----------------IHGLYR--------------------ALIS--------------
GK312_Glam       LSKHCG-FSR--GDT-FALSQSLMKVLPANQCLLQYQYMDLLAIVLSVNLWQPQACSTLT


29569_Tthe       -----------------------------------------------------IKERVE-
13773_Tthe       -----------------------------------------------FSKAI-AKHLGQD
20618_Tthe       -----------------------------------------------LAKFK-KQAFAEK
20619_Tthe       -----------------------------------------------LSKFK-RQHFCEN
n8_Tthe          -----------------------------------------------------IQQNGQ-
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -----------------------------------------------------RMLF---
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  -----------------------------------------------LRRHK-IKHHAEP
CC1G_13883_Ccin  ------------------------------------------------TSYTWTLSHWNT
GK312_Glam       DFLNHIQALSHQAGYKLKTAMRINPHSFLAVSIIRLCSRLKSFVNGSLEQLQ-VKTPAQQ


29569_Tthe       --------------------QITEEPVDEHLDFKYQKLLDVIKGSGDKNNLGFLQQKIDY
13773_Tthe       QL-QLFFKQMINLSEVRLLKHIEKDGVNSVVDFQPVEDETMKKGTSFKTILYRQKQVISF
20618_Tthe       FF-IKTTEFLLQRINPPKA-----------------------------------------
20619_Tthe       FL-CETIDHIRNLIGSNKF-----------------------------------------
n8_Tthe          --------------------QTN-------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  VI-VGIGT----------------------------------------------------
CC1G_13883_Ccin  LT-LGLQ-----------------------------------------------------
GK312_Glam       NILVTLRT----------------------------------------------------


29569_Tthe       LTMISNRLQISLFDLLNLLPSKY-----------LAQLFQD---------------YKQQ
13773_Tthe       ITSFANI--ISQLDKLYEDESQSLLRLCMVGFKQFSSFYEKYKEPLNEGIVQLMREMKKH
20618_Tthe       -KSITHELIVSYYDTLNKISQCI-----------DSTIYAKLPE----------------
20619_Tthe       -KSPSQDLLISYYDTLDKICSSL-----------DISIIKKIPD----------------
n8_Tthe          --------------------------------------------------------QEQA
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -------------------------------------------E----------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       ENVMVNIILASV-------------SGLSQPNKIF--EDI---------------KIDLG
13773_Tthe       QSIYII------------------------------------------------------
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          LNPAVNAVDNAI-------------LGVSEIKKKYSIDDYRIKGKKAIENIEKIIQINDG
n29_Tthe         ----------------------------------------NVKLKAI-------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ----------------------------------------TLQNKRTNNDVS--------
n508_Tthe        -----------------------------------------------NK-----------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -----------------------------------------------------------Q
n737_Tthe        ----------------------------------------RQKADEAIKDLYKIINLDDS
n858_Tthe        ----------------------------------------KDAAKKAINDLRQIIDYDKS
CC1G_04234_Ccin  -------MLAGA-------------PGMPRLTAIM--GDV--------------------
CC1G_13883_Ccin  -------RLCSA-------------SAITRLNQLC--ADI--------------------
GK312_Glam       -------LLQRMQLLITDALNGQATVAAKSNIFLK--DLR--------------------


29569_Tthe       DKF---DYENQYLKAHCQNYE--------DC------------LNQD-EQEQQSLED-DE
13773_Tthe       -WLENLVQNGLVQSIKLPDNSFLSMQEYYETLKSCSQFWKSLFNCQL------WTDE---
20618_Tthe       ------------------NMK--------DLV---FQSIQ-----------NITRQI-RQ
20619_Tthe       ------------------DKK--------KLI---FDEIK-----------RVCKTI-QK
n8_Tthe          NWLINHERADQYRRRKLPNYL----------------------LQRT-DQNH--------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -YLSENDEDK--N----------------------DQFMQNLLRCRT------NQRD---
n131_Tthe        ------------------------------------------------------------
n502_Tthe        --------------------I----------------------LNENQQDQT--------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -------------------------------------------------------RD---
n679_Tthe        NIIFNY------------KYK--------DLS---YNSII-----------AITLWCSQK
n737_Tthe        YWLFRSEQAKELQRRKIPSYL----------------------LNKD-CSKY--------
n858_Tthe        SWLFESEQAKRFQRRKIPSYL----------------------LHKD-SSEY--------
CC1G_04234_Ccin  -------------------------------------------AIEQ-GRAE--------
CC1G_13883_Ccin  -------------------------------------------IHKD-GLDT--------
GK312_Glam       -------------------------------------------STFP-TMYS--------


29569_Tthe       ELEELTPQIKTR------------------------------------------------
13773_Tthe       TLHHFSAQFFQY------------------------------------------------
20618_Tthe       DLQEKKPYISFRIQCLM-----SIIK--------------N-------------------
20619_Tthe       DLQDKKEYIPSRVTCLQ-----NIVK--------------V-------------------
n8_Tthe          --PTYICQSPLS------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         DVEYYIPQLCSF------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        --NAFINQQNFE------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        DLEFYLPQICNF------------------------------------------------
n679_Tthe        NKDEKKPLGCTTISLFD-----DQFR--------------L-------------------
n737_Tthe        --PKYLCQSNLS------------------------------------------------
n858_Tthe        --PTYLCQSNLS------------------------------------------------
CC1G_04234_Ccin  --ED-------------------------------FDDRTAVGPRS--------------
CC1G_13883_Ccin  --EE-------------------------------IFYAQAFLARYTAQGRPVSGYFLIC
GK312_Glam       --EFIRPYCCAFIVLLDVCAYLNKRGVEIGLDTTDMQESLLIIWRS--------------


29569_Tthe       ------------------------------------------------------------
13773_Tthe       -----------------II------------------------QLLEN------------
20618_Tthe       ---------FQHKYQDLINDEDLLINNILFNGL-----YPQSIEFLKH------------
20619_Tthe       ---------FSTRYSELIDEE-NLIDDLIFNGL-----YPQTVEFLEN------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ---------RQGKYHLYIWP-------DTLPDTSYTSITPGLV-----------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  -----------------------------EDDL-----APPAVSARTS------------
CC1G_13883_Ccin  CILEIEWTVLAQTMTEPVVNR-ATVTEAAAANK-----AWLALSRNPA------------
GK312_Glam       -----------------------------LIVL-----DAPYLGHKDTKKGLYFHLSSGF


29569_Tthe       ------IFFSRYIIPLVLHQ---------------------------------LI-DFK-
13773_Tthe       ----TDLS------YKVVYT---------------------------------QQ-IEED
20618_Tthe       ----I------------------------------------------------QK-YNRK
20619_Tthe       ----I------------------------------------------------QS-YKMD
n8_Tthe          ------EVFVKEVTIIIKVN---------------------------------LI-NFKS
n29_Tthe         ---------VKNLEINILS-----------------------------------------
n73_Tthe         ------IA----------------------------------------------------
n131_Tthe        ----------QS------------------------------------------------
n502_Tthe        ------NAYQDQNEINLFRNNSNNFENSGKYFFLFLVNILSNNLKVQFNQANVESFQDED
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------FV----------------------------------------------------
n679_Tthe        ---------------------------------------------------------TDD
n737_Tthe        ------LAFSKVNSINLNVN---------------------------------LD-EYIN
n858_Tthe        ------LAFANVNSIKLVVL---------------------------------LG-NYED
CC1G_04234_Ccin  ----LDEDDDDQEG----------------------------------------------
CC1G_13883_Ccin  ----LELQVDDNTKSTLR-----------------------------AGVAYSMQ-CFTD
GK312_Glam       YCDSLLDFLLEHLN----------------------------------------------


29569_Tthe       -------QD--------PS-IQMS------------------------------------
13773_Tthe       EIKDKNQME--------IEQDKESKIQDIIR---EIQQVQYVANNEVDLQFFYRVTLLFD
20618_Tthe       ---------------------ER-------------------------------------
20619_Tthe       EIKENTSVS--------EENRKK-------------------------------------
n8_Tthe          QLYDK-QML--------IN-KEKT------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -------------------FQQEFKVQKMVN---YIKQAG--------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        EIQCENQEDGGLSKDIECQQNQENQVQQQQN---PIQEEQC-------------------
n508_Tthe        ---------------QQ-------------------------------------------
n545_Tthe        -------------------FHEELKNDSLKE---FLKKAG--------------------
n679_Tthe        NIKQINFSH--------QKT----------------------------------------
n737_Tthe        QLREKKPAE--------VD-----------------------------------------
n858_Tthe        KLQDWKQEP--------PQ-NEKKQEEKMI------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  LLVQIEAM--------RVDPSIDIYAWETMAESLKLASVCCIALRELDEHLHSRILLLL-
GK312_Glam       ------------------------------------------------------------


29569_Tthe       ------------------------------------------------------------
13773_Tthe       SVLPSIKPALFSNYI-YQFYKSII-------------------LKLRKLPRSIVLLKLLR
20618_Tthe       ------TRTEVSSSIQYRLLLCII-------------------TILSK-HKNLFPQS-LN
20619_Tthe       ------EKKEFSTFIQYRLLLYII-------------------TTLQK-QRNVTPLT-LP
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  -------------------------SPSSEESLPAKPT----------------------
CC1G_13883_Ccin  -----------------------SNTSPISDNLVQEAALKSTTV----------------
GK312_Glam       -------------------------ISTSDNNFFSKLTEV--------------------


29569_Tthe       ------------------------------------------------------------
13773_Tthe       CLNEYIEKN-NILKGLKKYI--K--------------KDITSQIKIFFSELYKNLGKYQD
20618_Tthe       PNNDKDKNFYQKLILNTDKTLSTDEKAIA----NAIQTLSTFGFSNYENE---LANFV-K
20619_Tthe       PVNDSQKKFQLKLRQYEDRI--KGDKEIS----NAIQTLSTFKFKTYEKE---LTNFL-K
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------QINFYFAHLL--------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        -------SVCLIEFQESDQI--R----------------ITICDHIF-----------HS
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------KIDFFFGHML--------
n679_Tthe        ----------------------------E----QAFTN----------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  --------------------LVRSFPAIAADMTTQLRKFVTSPLPLFE------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       -------------------SILGRLE----DIYGMQQSQAQLGS----------------
13773_Tthe       ELL----------IDCLKTMLSIPFEVLLIDNYSFFR--KNLIVALKKGFELGVQNVSMG
20618_Tthe       DNV---------------------------------------LDYLDN----KNKNIRKA
20619_Tthe       DNV---------------------------------------LDYLDN----KNKIIRKA
n8_Tthe          -------------------TNNQPLE----DQYSVK-IKAELVT----------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -------------YF---------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ECLLQWLKSQENCPNCRKDLQRRKLK----YWYSIQ-VRKQLRI----------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -------------CF---------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        -------------------------W----DCKSLT-IEAGLVT----------------
n858_Tthe        -------------------KDDKPIK----YEKRIE-IEAGLVT----------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------FEFA-------------S----ETRAPPPL
GK312_Glam       ------------------------------------------------------------


29569_Tthe       --------------------------AQNINTQDSGGSLSQNSNA---------------
13773_Tthe       FAAIECLQKII-KRSKNRVVFKYLKLVIPYLSEYL-SITKGELEEITSDMKYKVQSNNQQ
20618_Tthe       AAKAGCL-LYV-KKERGQSISKNIMY--E-------------------------------
20619_Tthe       AAKAGCL-LCV-KKGKDNLISKSVMY--K-------------------------------
n8_Tthe          --------------------------A------FLYKLYFNKNKN---------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -----YIRSLSYI--------------------------------VNKNEKYQLL-----
n131_Tthe        ------------------------------------------------------------
n502_Tthe        --------------------------MMNDRSAYSINLFLGQPKSK--------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -----YLKSVAQT--------------------------------VNKNQIQDIP-----
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  AAAAKCLALCI-KLAPGDDLIMSNMY--S-LLNYIAA----------------TSKEVYD
GK312_Glam       ------------------------NWS-T-LFKHLAFHTEPVPFVFSSDRKYSLEEEMPA


29569_Tthe       ------------------------------------------------------------
13773_Tthe       RDIFNLTVS--------------------------ELGQRKKDLIERVTNLLGDIGGESH
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ----------------------------------------------AIEKM---------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ----------------------------------------------QVWNV---------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  -----------LPSNSALLARRKTVTGAQTVPT---------------------------
CC1G_13883_Ccin  ASLFDVKGDF--------------------------VGDTHKTLHSLQSGLHGLSED---
GK312_Glam       GSLHHLRESLIAELNSRSLSHRKTRDAVNSIPDGYICGLYALTLIEIYSALWSGRGS---


29569_Tthe       ------------------------------------------------------------
13773_Tthe       LIVLSEKGFQGNVERQLLSEFENLQISKKGVSLISWDYEAKVLFPLPLLAKKIDINLTKL
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       ------------------------------------------------------------
13773_Tthe       LPRMVELTLNPDDKIKVYACEAIHAITIYMIGTQASSIQGGQKKRGRDMENLIKSKEEFS
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       ------------------------------------------------------------
13773_Tthe       KIYSKLFPTIFSIGSNSSHPSCQLMNQLILQISRWFANSKQLESPEVA------------
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------QLELYDFFSE-HYSNKYLTAKELYKEINQKQN--HN
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------LNEFFSSFVE-FYSSKQLMSAEMVENLAMGKKYAVP
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       --------------------------------------------------------S---
13773_Tthe       -------------ELLDNIMNFISSKDNNNLRELAANCLGQFIKWTLKQNTEQEIKVNHS
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ------------------------------------------------------RAD---
n29_Tthe         ------------------------------------------------------------
n73_Tthe         YQDQNGHYVAPNAE-------------------------------------EQQIAD---
n131_Tthe        ------------------------------------------------------------
n502_Tthe        -------------------------------------------------------ST---
n508_Tthe        ------------------------------------------------------------
n545_Tthe        YKLNKSNNGNSNEA-------------------------------------NMKIKQ---
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------GAD---
n858_Tthe        ------------------------------------------------------GAD---
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       ------------------QNLFIQ-------------------------------KVYIT
13773_Tthe       NIKSALRRIISFSGQPDLSKRFGALLALKEVVNNIKNESFLVDKFIMETIQTSM-RIVQK
20618_Tthe       ----------------------------------------ILEKFMSVAISDSEDEIRQT
20619_Tthe       ----------------------------------------ILEKFMSVAVSDAEDEIRQT
n8_Tthe          -------------------------------------------------------EVLKK
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -------------------------------------------------------DVIQK
n131_Tthe        ------------------------------------------------------------
n502_Tthe        --------------------TFGE-------------------------------QVAES
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -------------------------------------------------------EVISS
n679_Tthe        ------------------------------------------------------------
n737_Tthe        -------------------------------------------------------EVIKN
n858_Tthe        -------------------------------------------------------EVIKN
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       NLRE--------------------------------------------------------
13773_Tthe       TGVSNEVEDNFNILIKLQTNIIQKNYKTLKAKNENRSGQFKLLDSLLDWLYSYGFFNSSY
20618_Tthe       ML--KSLNENFDQYLN-EPNYLKKLFL---CVNDSNTQVQQLVLTIL-------------
20619_Tthe       ML--KSLNENFDQYLI-EPIYLKKLFF---CVNDSNLEVQQLALTTL-------------
n8_Tthe          TLRE--------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         YGTT--------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        NQQ---------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        YGTS--------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ILRK--------------------------------------------------------
n858_Tthe        ILRE--------------------------------------------------------
CC1G_04234_Ccin  ----------------------------------LPLHLRSLRKP---------------
CC1G_13883_Ccin  ----------------------------------EKRLIGISTISVV-------------
GK312_Glam       ----------------------------------LSLAFNKKEKSVV-------------


29569_Tthe       ----------------------------------------------------FYRSLKFF
13773_Tthe       LVRKSSFELWQSILNREDSDISCKKFLAKRKQGDNLFGDQIKQLKLAINSQSYF--REIN
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ----------------------------------------------------VYYKYKIK
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -------------------EQDE-----------------------------IKQYPQFK
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ----------------------------------------------------YYQRHKIN
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ----------------------------------------------------IYKEYKIA
n858_Tthe        ----------------------------------------------------IFKQAKVK
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       MEKIYRKNNDKAQYVLSYLQKICKNERDYE-LDQTLFSYEDLKRDRIVLYRLAMSGTKKL
13773_Tthe       VL----LSQLDVVTFIVK-----NNFFS--------------------------------
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          LQ----PQD-NKTFILKI-----EGYREYLSGHYPMLSYDR---------------VRTN
n29_Tthe         ------------------------------------------------------------
n73_Tthe         LK----STNIILKNYK-------RKIIL--------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ---------------------------QQFYRKTPMFPFNK---------------VKQL
n508_Tthe        ------------------------------------------------------------
n545_Tthe        IL----PEDISLQNYINI-----QDFIQ--------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        LK----PKDQNHQFILQV-----KGFREYLAGNHPMLNYDR---------------VRTS
n858_Tthe        LE----PNNPDHQFILQI-----KGFREYLTGNYPMLSYDR---------------VRIN
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       L-FNYLQDKQILTKYAG------NCIFDFKKKEIFLDYYKRFITPA-------EASLSN-
13773_Tthe       ---------------------------------------------V-------QE-----
20618_Tthe       ---------CRLSRYNP------SDIIPFLKKTLF---------EFLSQLKIN-------
20619_Tthe       ---------CRLSKYNP------SDIVPFLKKTLY---------EYISQLSYNKK-----
n8_Tthe          L--------------RI------KKSLKVILDQKQNAVQNQKLFP---------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ---------------------------------------------N-------ES-----
n131_Tthe        ------------------------------------------------------------
n502_Tthe        KRFNSLQGEFY-----HNSQTQGNI-------------------------------LNNG
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ---------------------------------------------I-------KE-----
n679_Tthe        ------------------------------------------------------------
n737_Tthe        L--------------RG------LDHLDVKLTEMPINNQQADQFP---------------
n858_Tthe        L--------------RG------HEHLDVRLTEIPIKSRKADLFP---------------
CC1G_04234_Ccin  ----------RLSD-DP------L--------------------GQLETDSFNT------
CC1G_13883_Ccin  -------------TR---------------------------------------------
GK312_Glam       ---------GRLSRYNI------Y--------------------GYLPKEPFNE------


29569_Tthe       --GMDDTVFRISAN----------------------------------------------
13773_Tthe       -------------E----------------------------------------------
20618_Tthe       -------------NLEN-EKQ----------MINLLS-----------------SLTCLI
20619_Tthe       -------------RFEN-EKK----------IINLLK-----------------GLVCLI
n8_Tthe          -----PEFERLVIT----------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         -------------N----------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        QKTETDNIQQTN------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        -------------R----------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        -----PIYERKQSE----------------------------------------------
n858_Tthe        -----PTIMRKKTD----------------------------------------------
CC1G_04234_Ccin  --------------------------------------------PSHSSPSLTS------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       --------------LINFEKEIVRQKSEDKGGIYLLNESAGDVPLYFSSSSPLDAENCIV


29569_Tthe       ------------------------------------------------------------
13773_Tthe       ----------LLQFEDIIDSFCTNIENFFN----------------SL----FKIQ--ES
20618_Tthe       KNGPELVRPHSQSIANILLNFLKDQKITNNMI-------------PEL----LKTFSQLS
20619_Tthe       KNDTEVVKPHSMTIATILLKFLKDSTITNNMI-------------PEL----LKAFSQLS
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------VN-------------KFP------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  -----------------LALEFQMEEVTRLTI-------------SMLL-QRLRSAEPTV
GK312_Glam       S----------------V-GPIPDEPLTNNKSSAGISSTNFFKFYAELFCS---VYEQLS


29569_Tthe       --------LENY------------------------------------------------
13773_Tthe       YLKSDGLLMEILLDDAVDIDIQE-------NQYQAVINLFIKICEFMSLLSNDIL-----
20618_Tthe       SLGDNTIL--LYMDEIFPIFLQAMQDKSSTAKREAAVKSLVDILKYTGFVVLPYY-----
20619_Tthe       ALGDFQNL--IDMDEIFPIFLSAMQDKSSTFKRESAVKSLVEILKNTGFVVLPYY-----
n8_Tthe          -----INFNKSDNKH-QRFNKQE-------KTIEEIQNLL--------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        QL---------------------GQNNSKSIQRPTQV-EYQEVSFNGAIVRIPKPKIETN
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------QKTGSSIHRN-QLKEQLDLQKIYAFQKIPSA-----
n737_Tthe        ------------MEQ---------------------------------------------
n858_Tthe        ------------VAN---------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  EAAIAYNL--VDLALIA-----------------------------------PR------
GK312_Glam       SY----------------------------------------------------------


29569_Tthe       ------------------------------------------------CRALQTS-----
13773_Tthe       ----------------------------N-----------------------------FT
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          ----------------------------KLVQNDILFKQGGKIKQLYLSNNYKIIDNTNQ
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        TQKVIEVENEEEEEKKEQLEEQNQDICIQQIQNEQIIEQNSKIKNDSLSIQQENKSDLNQ
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       -------QHKI------------------CALRNAI------------------------
13773_Tthe       TFLDVLLNITL------------------E--NKYS------------------------
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          IIFQDQFNINW------------------E--DYQQ------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        NGSNKHIDLKQNDNQNMFECISLNNSIQIE------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ---GIFTPIDW------------------S--NYYE------------------------
n858_Tthe        ---SKYQKVNW------------------K--KFHG------------------------
CC1G_04234_Ccin  --------------------------------------------ALMSGRPL--------
CC1G_13883_Ccin  -----------------------------------NAFVDIVRVFS--------------
GK312_Glam       --------------------------------------------TFLEELIIHQEVAHKW


29569_Tthe       ---------------ALIRFLTPFL--------------------------ET--FSSQF
13773_Tthe       ---------------IFLQMLLKPNHLIRGMNIDIFLTKSELYFEKITPVIKA--LQEIT
20618_Tthe       -----------------------------------------------------KYP----
20619_Tthe       -----------------------------------------------------KYP----
n8_Tthe          ---------------IPALLWYPPQ--------------------------KL--PRYVP
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        -----------------------FL--------------------------EIDFP----
n737_Tthe        ---------------VPILLWYPWV--------------------------DF--PEKD-
n858_Tthe        ---------------VSILLWYPWI--------------------------EF--PEEKD
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  -AINRSANPD-------------------------------------------DPRFSNN
GK312_Glam       TSICFASNPKTHTRTIPVFLV-------------------------------KDVDIPDP


29569_Tthe       NQ-SATNKYLI---------KAAC---WRIV-RFILF---VHDGSISYVAL---------
13773_Tthe       -QEGVDFFQDYVLKALEDIFKGNK---PQKFEEIISD---EQKLKENELKIFLEGIKLIF
20618_Tthe       ------------------------------------------------------------
20619_Tthe       ------------------------------------------------------------
n8_Tthe          -QQNINDLIEY---------QKQN---LQKYKESQET---FNEHKKKYLKL---------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------DC------------QQENSQCFRKRKHLRESWFKKSEQSKQILNI-EEDNS---
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------RSAMMNPADILLERY---------------------------------------
CC1G_13883_Ccin  ---------------MVLAAQ---------------------------------------
GK312_Glam       LPDLLFRKIVFEIVNLLVSAE---------------------------------------


29569_Tthe       ------------------------VFLIFCFELLFSERS-LLNQEHERFLHLLLAFLHVY
13773_Tthe       KLCSQSSRYTIRYIEKAISGILNGV-----------------------------------
20618_Tthe       ------------------------SFLEIILSLMKNEVNVEMRQQCMRLIGCLGAIDYFY
20619_Tthe       ------------------------NFLEIVFSLMKNEVNTEMRYQCMRLIGCVGAIDHFF
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------NFE---------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  ------------------------------------------------------------
GK312_Glam       ------------------------------------------------------------


29569_Tthe       RNR-EDA---------------L-------------------------------------
13773_Tthe       ------------------------------------------------------------
20618_Tthe       YKKVSDKVRNRLTASPSQDNRQLINDIIKVSLKKKFKYFKKLSAAKQQESSSILTKQLHQ
20619_Tthe       YKKVIDKIKNHSITSSFADNRILVNYIVTKSFRKRFKFMKKLIKYQQTNQSSELPFQLHK
n8_Tthe          ------------------------------------------------------------
n29_Tthe         ------------------------------------------------------------
n73_Tthe         ------------------------------------------------------------
n131_Tthe        ------------------------------------------------------------
n502_Tthe        ------------------------------------------------------------
n508_Tthe        ------------------------------------------------------------
n545_Tthe        ------------------------------------------------------------
n679_Tthe        ------------------------------------------------------------
n737_Tthe        ------------------------------------------------------------
n858_Tthe        ------------------------------------------------------------
CC1G_04234_Ccin  ------------------------------------------------------------
CC1G_13883_Ccin  -------------------------------------------</